DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG8539 and cpo

Sequence 1:NP_001261520.1 Gene:CG8539 FlyBaseID:FBgn0035791 Length:385 Species:Drosophila melanogaster
Sequence 2:NP_001139101.1 Gene:cpo ZFINID:ZDB-GENE-070619-6 Length:363 Species:Danio rerio

Alignment Length:335 Identity:95/336 (28%)
Similarity:157/336 (47%) Gaps:27/336 (8%)


  Fly     5 LCGIVVLVTIVVNQLSEAREVRRRRGLMLQLDNYLSY---DGIMQYLDELALSHSNRVTLKDVAR 66
            :..|:|::|:|...       |...||..:..:|..|   |.|..:::::...:.:.|:.....:
Zfish     6 ITSILVVLTLVAQD-------RLAGGLEHKSYDYTKYHTMDEISAWMNQMQRENPDVVSTMTYGQ 63

  Fly    67 TYENRALKMAIITNGDGRPGKRVIFLDAALHSREWMTPAAALLTIHKLVVEFAENSD---LLTDY 128
            |||.|.:.:..|......| |:.|::|..:|:|||:.||.....:.:::..:..:|.   |..:.
Zfish    64 TYEKRNITLLKIGFSSTTP-KKAIWMDCGIHAREWIAPAFCQHFVKEVLGSYKTDSRVNMLFKNL 127

  Fly   129 DWHIMPLANPDGYEYS--RNTERYWRNTRTP--NGGNCFGTNLNRNFAVDWN-VGFPELKDPCDE 188
            |::|.|:.|.|||.||  .|:.|.||.:|:|  ....|.||:|||||..:|. ||..  ::.|.|
Zfish   128 DFYITPVLNMDGYIYSWLNNSTRLWRKSRSPCHENSTCSGTDLNRNFYANWGMVGIS--RNCCSE 190

  Fly   189 NYAGSSPFSEVEARTVRDIMHGLVESKRAVMYLSLHTANRSVFYPWVYDTDPVSNQKEHDEIGRF 253
            .|.|::..||.||..|.|.:.  ......:.||::|:..:.:..|:.:......|..|..|:|..
Zfish   191 VYNGATALSEPEAEAVTDFLG--AHQNHLLCYLTIHSYGQLILVPYGHPNISAPNYDELMEVGLA 253

  Fly   254 VADRILQSTGTFIKTWQYAKYAGTFGGTSMDYALLAGFPLSFVFEMSGTGRDHVEYKFFPPARDI 318
            .|..|....|...|............|:|.|:|.|.|.|.||.||:    ||..::.|..|...|
Zfish   254 AAKAIKAVHGKSYKVGSSPDVLYPNSGSSRDFARLIGIPYSFTFEL----RDEGQHGFILPEDQI 314

  Fly   319 RHLAEESWTG 328
            :...:|::.|
Zfish   315 QPTCQEAYEG 324

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG8539NP_001261520.1 M14_CP_A-B_like 38..335 CDD:199844 88/303 (29%)
cpoNP_001139101.1 M14_CP_A-B_like 35..332 CDD:199844 87/300 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C70065891
eggNOG 1 0.900 E1_COG2866
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 D208397at33208
OrthoFinder 1 1.000 FOG0000073
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
43.840

Return to query results.
Submit another query.