DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: Cyp316a1 and Cyp313a1

Sequence 1:NP_648129.2 Gene:Cyp316a1 FlyBaseID:FBgn0035790 Length:484 Species:Drosophila melanogaster
Sequence 2:NP_650368.1 Gene:Cyp313a1 FlyBaseID:FBgn0038236 Length:492 Species:Drosophila melanogaster

Alignment Length:502 Identity:122/503 (24%)
Similarity:217/503 (43%) Gaps:58/503 (12%)


  Fly     2 ILTATFICFCLASAFNYFRARRQR--SLIKNLKGPFTWPLMGAMHKLLFLTPINFFQRS----TE 60
            :||...:....|..:.||...|:|  .|:..:.||...|::|:.     |..|..::|.    |:
  Fly     1 MLTINLLLAVGALFWIYFLWSRRRLYFLMLKIPGPIGLPILGSS-----LENIITYKRKLSFRTK 60

  Fly    61 YLTKYGTFSRCWVFHRLFIPLADLELSRQLLEN-DTHLETGY--ELMKDWLVGGVLMCQSEQWQK 122
            ||.|||:....|:....||...|.::...:..: |.|.::.:  ..:...:..|:|..|...|..
  Fly    61 YLNKYGSTILTWMGPVPFIVTRDPKVVEDIFSSPDCHNKSQHIVNAITSCMGNGLLGKQDPHWLD 125

  Fly   123 RHSLISGLFDKGNLEQLIDLSRHQTEQLLQKLAKQADQKVFDIWYTVSPIVLDLMVMTTCGAK-P 186
            |....:..|.:..|.....:...:|:.|:..|....|:...|:...:......:...||.|:: .
  Fly   126 RRKHFNPSFKQDLLLSFFHIFDAETKVLMNLLDTYVDKGEIDVVPEMLRWSFKIAAQTTMGSEVK 190

  Fly   187 SEEYSKNLKDLSEIYRKRFLSLQSANRFNYWLSSPFMRKRQNRLIKRLNDEHNNLMAMHQSQNQL 251
            .:|:.|| ..|.|    .|.||.|.:..|  :..|.:   |||:|.::.. ::.|.|.:.|:.|.
  Fly   191 HDEHFKN-GSLVE----SFESLISHSTLN--ILMPLV---QNRMISKICG-YDKLRADNFSRIQK 244

  Fly   252 KIENGLDIYQLRPIPLKDHKSLLEILLES-----KDPQLTGEEICGELNTCNYLGYQLCSPALCF 311
            .::|.:: .::.|:|..|......|::..     :...:|..::..|.......||...:..:..
  Fly   245 MLDNVVN-KKVNPLPKTDSDPESNIVINRAMELYRKGDITYMDVKSECCIMIAAGYDTSALTVYH 308

  Fly   312 CLVTIARNPSVQQKCLDELNLAQIKDQGW------DLEKLNYLDAVLHETMRLYPPQVIVGRQLK 370
            .|..:|.:|..|:...:||| ....|.|.      |::||:||:.|:.||:||.|...|..|:.|
  Fly   309 ALFLLANHPEHQEAVFEELN-GVFPDAGHFGITYPDMQKLDYLERVIKETLRLIPAIPITARETK 372

  Fly   371 KDFPYTHSIVGDAELPCGSEIYINLYELQRN-EVRYPKANHFDAQRFL------DSPPELLSYSL 428
            .|...::.::    :|.|..|.|:::...|| ||..|.|::|:...||      ..|...:.::.
  Fly   373 NDVRLSNGVL----IPKGVVIGIDMFHTHRNPEVWGPDADNFNPDNFLAENMEQKHPYAYIPFAR 433

  Fly   429 GPRCCPARKFSMQLLKTLLAPILANFEV--------LPYGDEVRLDL 467
            |.|.|...|::|...|..|..||.|:::        |.|.|.:.:.|
  Fly   434 GKRNCIGSKYAMMSSKFALCRILRNYKISTSTLYKDLVYVDNMTMKL 480

Known Domains:


GeneSequenceDomainRegion External IDIdentity
Cyp316a1NP_648129.2 p450 33..466 CDD:299894 113/467 (24%)
Cyp313a1NP_650368.1 p450 33..463 CDD:299894 110/452 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E2759_KOG0157
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 102 1.000 Inparanoid score I1613
Isobase 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
21.950

Return to query results.
Submit another query.