DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: Cyp316a1 and cyp4t8

Sequence 1:NP_648129.2 Gene:Cyp316a1 FlyBaseID:FBgn0035790 Length:484 Species:Drosophila melanogaster
Sequence 2:NP_954686.2 Gene:cyp4t8 ZFINID:ZDB-GENE-031219-3 Length:509 Species:Danio rerio

Alignment Length:411 Identity:103/412 (25%)
Similarity:181/412 (44%) Gaps:48/412 (12%)


  Fly   101 YELMKDWLVGGVLMCQSEQWQKRHSLISGLFDKGNLEQLIDLSRHQTEQLLQKL-AKQADQKVFD 164
            |:....||..|:|:...::|.:...|::..|....|:..:.|....|:.:|.|. .....::.|:
Zfish   115 YKFFIPWLGDGLLVSTGQKWFRHRRLLTPGFHYDVLKPYVKLISDSTKVMLDKWEVHSRSEESFE 179

  Fly   165 IWYTVSPIVLDLMV----------MTTCGAKPSEEYSKNLKDLSEIYRKRFLSLQSANRFNYWLS 219
            ::..||.:.||.::          .|..|..|   |.:.:.||..:...||......::..:.||
Zfish   180 LFKHVSLMTLDSIMKCAFSCNSNCQTDSGTNP---YIQAVFDLCHLVNLRFRVFPYHSKAIFHLS 241

  Fly   220 SPFMRKRQNRLIKRLNDEHNNLMAMHQSQNQ-LKIENGLDIYQLRPIPLKDHKSLLEILLESKDP 283
            ....|.|     |..:..||:...:.:.:.: ||:|....|.:.|     .:...|:|||.::|.
Zfish   242 PHGYRFR-----KAASIAHNHTAEVIRKRKEVLKMEEEQGIVKNR-----RYLDFLDILLSARDE 296

  Fly   284 Q---LTGEEICGELNTCNYLGYQLCSPALCFCLVTIARNPSVQQKCLDELNLAQIKDQG-----W 340
            .   |:.|:|..|::|..:.|:...:..:.:....:|.||..|:||..|:..|.   .|     |
Zfish   297 HQQGLSDEDIRAEVDTFMFEGHDTTASGISWIFYNLACNPEHQEKCRQEIQQAL---DGKATLEW 358

  Fly   341 -DLEKLNYLDAVLHETMRLYPPQVIVGRQLKKDFPYTHSIVGDAELPCGSEIYINLYELQRNEVR 404
             ||.|:.|....:.|::||:||...:.|:|.|  |.|  ......:|.|..|.:::|.:..|...
Zfish   359 EDLNKIPYTTMCIKESLRLHPPVPGISRKLTK--PLT--FFDGRTVPEGCTIGVSIYGIHMNSTV 419

  Fly   405 YPKANHFDAQRFLD------SPPELLSYSLGPRCCPARKFSMQLLKTLLAPILANFEVLPYGDEV 463
            :.....||..|||.      ||...:.:|.|||.|..:.|:|..:|..:|..|..:.::...|..
Zfish   420 WENPYKFDPLRFLPENVANRSPHAFVPFSAGPRNCIGQNFAMNEMKVAVALTLKRYYLIKDPDHT 484

  Fly   464 -RLDLRLVLGSSNGFQLALKP 483
             ::..::||.|.||..:.:||
Zfish   485 PKMIPQVVLRSLNGIHIKIKP 505

Known Domains:


GeneSequenceDomainRegion External IDIdentity
Cyp316a1NP_648129.2 p450 33..466 CDD:299894 96/393 (24%)
cyp4t8NP_954686.2 p450 46..501 CDD:306555 101/406 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E2759_KOG0157
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 D1247045at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.