DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: Cyp316a1 and Cyp4e2

Sequence 1:NP_648129.2 Gene:Cyp316a1 FlyBaseID:FBgn0035790 Length:484 Species:Drosophila melanogaster
Sequence 2:NP_001286196.1 Gene:Cyp4e2 FlyBaseID:FBgn0014469 Length:526 Species:Drosophila melanogaster

Alignment Length:547 Identity:126/548 (23%)
Similarity:224/548 (41%) Gaps:93/548 (17%)


  Fly     1 MILTATFICFCLASAFNYFRARRQRSLIKNLKGPFTWPLMGAMHKL------LFLTPINFFQR-- 57
            :.|....:.:...|.|      |:|.::....||...||||..|::      :..|..:::.:  
  Fly     9 LALPLLLVAYLELSTF------RRRRVLNKFNGPRGLPLMGNAHQMGKNPSEILDTVFSWWHQYG 67

  Fly    58 STEYLTKYGTFSRCWVFHRLFIPLADLELSRQLLENDTHLETGYELMKDWLVGGVLMCQSEQWQK 122
            ...::...||:|...|....::   :..||.|.|...:.:   |:|...||..|:|.....:|.|
  Fly    68 KDNFVFWIGTYSNVLVTSSKYL---EFILSSQTLITKSDI---YQLTHPWLGLGLLTSTGSKWHK 126

  Fly   123 RHSLISGLFDKGNLEQLIDLSRHQTEQLLQKL-AKQADQKVFDIWYTVSPIVLDLMVMTTCGA-- 184
            ...:|:..|....|:...::....:.:.::.| ...|...:||.......:.||::..|..|.  
  Fly   127 HRKMITPAFHFNILQDFHEVMNENSTKFIKHLKTVAAGDNIFDFQEQAHYLTLDVICDTAMGVSI 191

  Fly   185 KPSEEYSKNL----KDLSEIYRKRFLSLQSANRFNYWLSSPFMRKRQNRLIKRLNDEHNNLMAMH 245
            ...|..|.::    ||:......|.......|...|.|:..:  ...:|.:|.|.|..|.::|. 
  Fly   192 NAMENRSSSIVQAFKDMCYNINMRAFHPLKRNELLYRLAPDY--PAYSRTLKTLQDFTNEIIAK- 253

  Fly   246 QSQNQLKIE---------NGLDIYQLRPIPLKDHKSLLEILLESKDPQLTGEEICGELNTCNYLG 301
                  :||         |..|.:..:.:...|  :||...::.:  .|..:|:..|::|..:.|
  Fly   254 ------RIEAHKSGAVSTNAGDEFTRKKMAFLD--TLLSSTIDGR--PLNSKELYEEVSTFMFEG 308

  Fly   302 YQLCSPALCFCLVTIARNPSVQQKCLDEL-----NLAQIKDQGW-DLEKLNYLDAVLHETMRLYP 360
            :...:..:.|.:..::|:...|:|...|.     |....:|..: ::.::.|||..:.|..|:||
  Fly   309 HDTTTSGVSFAVYLLSRHQDEQRKLFKEQREVMGNSELGRDATFQEISQMKYLDLFIKEAQRVYP 373

  Fly   361 PQVIVGRQLKKDFPYTHSIVGDAELPCGSEIYINLYELQRNEVRYPKANHFDAQRF-LDSPP--E 422
            ....:||..:||:    .|.||. :|.|:.:.:.|..|..||..:...:.|..:|| |:.|.  |
  Fly   374 SVPFIGRFTEKDY----VIDGDL-VPKGTTLNLGLVMLGYNEKVFKDPHKFRPERFELEKPGPFE 433

  Fly   423 LLSYSLGPRCCPARKFSMQLLKTLLAPILANFEVLPYGDEV------------------------ 463
            .:.:|.|||.|..:||::..:||:::.|:.||||||..||:                        
  Fly   434 YVPFSAGPRNCIGQKFALLEIKTVVSKIIRNFEVLPALDELVSKDGYISTTIGLPDAERKKRDPY 498

  Fly   464 ------RLDLRLVLGSSNGFQLALKPR 484
                  .|...|.|.|.||..:.||.|
  Fly   499 RHKYDPILSAVLTLKSENGLYIRLKER 525

Known Domains:


GeneSequenceDomainRegion External IDIdentity
Cyp316a1NP_648129.2 p450 33..466 CDD:299894 113/496 (23%)
Cyp4e2NP_001286196.1 p450 35..469 CDD:278495 109/458 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E2759_KOG0157
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 120 1.000 Inparanoid score I1293
Isobase 00.000 Not matched by this tool.
OrthoDB 1 1.010 D1247045at2759
OrthoFinder 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 P PTHR24291
RoundUp 00.000 Not matched by this tool.
44.060

Return to query results.
Submit another query.