DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG8560 and oxy-5

DIOPT Version :10

Sequence 1:NP_648120.3 Gene:CG8560 / 38830 FlyBaseID:FBgn0035781 Length:418 Species:Drosophila melanogaster
Sequence 2:NP_001293404.1 Gene:oxy-5 / 24104659 WormBaseID:WBGene00045483 Length:162 Species:Caenorhabditis elegans


Alignment Length:56 Identity:15/56 - (26%)
Similarity:25/56 - (44%) Gaps:7/56 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly    71 QEGFEHLLEKYGVNYSVINENFGESLRQERDENQN-----QRLMNLRSAERSVSFK 121
            |..||.:.....|..|:  ||..:.|:..:..|.|     :|.|:..|..::.||:
 Worm    19 QSLFESIFGGKSVTKSI--ENQAQILKTPKVSNSNPSAPIKREMHSSSVLKAASFR 72

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG8560NP_648120.3 Propep_M14 27..99 CDD:460505 8/27 (30%)
M14_CP_A-B_like 123..414 CDD:349433
oxy-5NP_001293404.1 S36_mt 75..157 CDD:402493
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.