DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG8560 and CG43235

DIOPT Version :10

Sequence 1:NP_648120.3 Gene:CG8560 / 38830 FlyBaseID:FBgn0035781 Length:418 Species:Drosophila melanogaster
Sequence 2:NP_001245931.1 Gene:CG43235 / 12798301 FlyBaseID:FBgn0262880 Length:103 Species:Drosophila melanogaster


Alignment Length:95 Identity:21/95 - (22%)
Similarity:48/95 - (50%) Gaps:14/95 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly     6 AVVLLLA------SVALAVENYDGYKIYDINARNAFEKQL---LLRLSGNEAYDFFDLPRSLDAS 61
            |::||:.      |..:...:|:.|.:|.:..:...::|:   ||:.:.|  |:.:.  |.|:. 
  Fly     6 AMLLLITAWKSSLSDPIGPRSYENYSVYKVFIKTRSDQQVIDGLLKDTDN--YNLWH--RGLNV- 65

  Fly    62 SRVMVKPEDQEGFEHLLEKYGVNYSVINEN 91
            ..:||.|.:::.|..:::|..:...|:.:|
  Fly    66 VHIMVSPVEKDSFLAVMQKENIVVEVLIKN 95

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG8560NP_648120.3 Propep_M14 27..99 CDD:460505 15/68 (22%)
M14_CP_A-B_like 123..414 CDD:349433
CG43235NP_001245931.1 Propep_M14 33..102 CDD:460505 15/68 (22%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.