DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG18417 and CG17633

Sequence 1:NP_648119.1 Gene:CG18417 FlyBaseID:FBgn0035780 Length:427 Species:Drosophila melanogaster
Sequence 2:NP_609310.2 Gene:CG17633 FlyBaseID:FBgn0032144 Length:430 Species:Drosophila melanogaster

Alignment Length:445 Identity:152/446 (34%)
Similarity:231/446 (52%) Gaps:55/446 (12%)


  Fly     3 VVWVILALSCLSLSAGLQRTNKYEGYKIYEVSSEARSVAFSEALSELVKNASYYEVFSELNAGNP 67
            :::.:||: ..|.|...:|. :|:.|::|:|:||               ||...||..:|...:.
  Fly     7 LLFALLAI-VASASVSAERV-RYDNYRMYKVNSE---------------NAKQLEVLKDLEGSSD 54

  Fly    68 G--------------KIMVHPHEQVNFVQLMEENNVKYDIINRNVGLTLSRQFETNRMLRHWFPY 118
            .              :|:|.||:..:|::::.::.:||::.:|:|..:|....|.       ...
  Fly    55 SIMFLDGVHLVGADIQIIVAPHKVPDFLEILGKSEIKYELQSRDVQKSLDEIDEK-------VAI 112

  Fly   119 NGRLGT----ERYYNHEEINQFIEDLAGEHPRRVFLKTVGRSYEGRWLKTITITNGDARRN---K 176
            .||..|    .:||..::...:::.||..:|..|.|...|::|:||.:..:.||.|....|   |
  Fly   113 KGRATTAYNWAQYYELDDTYAWLQSLAQTNPGVVTLIEGGKTYQGRSILGVKITKGGETINGKAK 177

  Fly   177 NVILVDGGFHAREWISPAAATYLINQLVYN-LEDNADLLLDFDWVILPVVNPDGYEYTQLSEDTR 240
            ..|.::.|.||||||:|||||::||||:.: :|:..:|..::.|.:||..|||||.||..:  .|
  Fly   178 PGIFLEAGIHAREWIAPAAATFIINQLLTSEVENIKELAENYTWYVLPHANPDGYVYTHTT--NR 240

  Fly   241 MWRKTRKPSSSDCIGTDPNRNFDFHWNEEGASDDPCDNIYAGAKPFSEPEALVVGDLIHSYVDRG 305
            :|||||.|..| |.|.|||||:.|||||.|||...|.:.|||...|||.|.|.:...|.....:.
  Fly   241 LWRKTRTPYGS-CFGADPNRNWGFHWNEVGASSSACSDTYAGPSAFSEIETLSLSKFIEGLKGKV 304

  Fly   306 QMYLTLHSYGSLILYPWGWTAAVPDTEEDLHEVAAAGQSAIQEATGTIYKIGPSATTINYAASGA 370
            |:||:||:|...:|||:|.|:.:||...|..:|..|..:|:.:..||.|..|.....| |.|:||
  Fly   305 QLYLSLHAYSQYLLYPYGHTSDLPDNVADFEKVFDASIAAVNKRYGTTYTGGNIYDAI-YPAAGA 368

  Fly   371 SDDYAFNA-GFPISFTMELPFGG----TGFDPPASDIDSIVKETWVGIAAMARKV 420
            |.|:|:.. ...::|..||....    |||..||..|....:|....|.|||.:|
  Fly   369 SVDWAYGTQDVRMAFCYELRPSSTSYLTGFKLPAEQIVPASEELLDSIVAMATEV 423

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG18417NP_648119.1 Propep_M14 <65..99 CDD:280416 9/48 (19%)
M14_CP_A-B_like 127..420 CDD:199844 121/302 (40%)
CG17633NP_609310.2 MpaA 7..374 CDD:225421 137/395 (35%)
Propep_M14 34..105 CDD:280416 18/86 (21%)
M14_CP_A-B_like 125..423 CDD:199844 121/302 (40%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C70164013
eggNOG 1 0.900 E1_COG2866
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 66 1.000 Inparanoid score I2432
Isobase 1 0.950 0 Normalized mean entropy S1851
OrthoDB 1 1.010 D208397at33208
OrthoFinder 1 1.000 FOG0000073
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 P PTHR11705
RoundUp 00.000 Not matched by this tool.
76.940

Return to query results.
Submit another query.