DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG8563 and CG17633

Sequence 1:NP_001261515.1 Gene:CG8563 FlyBaseID:FBgn0035777 Length:440 Species:Drosophila melanogaster
Sequence 2:NP_609310.2 Gene:CG17633 FlyBaseID:FBgn0032144 Length:430 Species:Drosophila melanogaster

Alignment Length:450 Identity:119/450 (26%)
Similarity:206/450 (46%) Gaps:51/450 (11%)


  Fly     7 CSLALCLVGLAGLGIANNLAGYEGYTKYTVQHGDENAFKYMVDLQTNDAELDF----WLLTRNSS 67
            |.|...|..:|...::.....|:.|..|.|...:....:.:.||:.:...:.|    .|:..:..
  Fly     6 CLLFALLAIVASASVSAERVRYDNYRMYKVNSENAKQLEVLKDLEGSSDSIMFLDGVHLVGADIQ 70

  Fly    68 VLTVSPRRKTQFEASLSSLGVSYEMQPLMELMAALQANSSFADDNYDGEYEECQQDECEQAERPR 132
            :: |:|.:...|...|....:.||:|.                       .:.|:...|..|:..
  Fly    71 II-VAPHKVPDFLEILGKSEIKYELQS-----------------------RDVQKSLDEIDEKVA 111

  Fly   133 RRTRRQARGFFSHYPRYHEVLSFMSGLAARYPQFCRYESLGRSNEGRHIAALSI-----SLNSRV 192
            .:.|......::.|....:..:::..||...|........|::.:||.|..:.|     ::|.:.
  Fly   112 IKGRATTAYNWAQYYELDDTYAWLQSLAQTNPGVVTLIEGGKTYQGRSILGVKITKGGETINGKA 176

  Fly   193 RPRRVAYIQAATHGREWITTQTVLYLAYELL-SNLRAFTRVLQDVEIFLVPLVNPDGYEYTHTTD 256
            :|.  .:::|..|.||||......::..:|| |.:.....:.::...:::|..|||||.|||||:
  Fly   177 KPG--IFLEAGIHAREWIAPAAATFIINQLLTSEVENIKELAENYTWYVLPHANPDGYVYTHTTN 239

  Fly   257 RFWRKNRHRYAGHSCSGVDINRNFGNHWNYQGASQNLCSEVYSGTAPNSEPETSAVVRYLEFNRN 321
            |.|||.|..|.  ||.|.|.|||:|.|||..|||.:.||:.|:|.:..||.||.::.:::|..:.
  Fly   240 RLWRKTRTPYG--SCFGADPNRNWGFHWNEVGASSSACSDTYAGPSAFSEIETLSLSKFIEGLKG 302

  Fly   322 RVKLSLDVHSFGKFIFYPYGYAKNTVPPTVGTLRSV---ALRAANQIGRYRGTRYTTGTSASILY 383
            :|:|.|.:|::.:::.||||:..: :|..|.....|   ::.|.|:  || ||.||.|.....:|
  Fly   303 KVQLYLSLHAYSQYLLYPYGHTSD-LPDNVADFEKVFDASIAAVNK--RY-GTTYTGGNIYDAIY 363

  Fly   384 EASGSLDDFAYGNLGIPLSYTLEL-PGDE-----FHVPAHDIIHVCKETFAGFIEFIRHV 437
            .|:|:..|:|||...:.:::..|| |...     |.:||..|:...:|.....:.....|
  Fly   364 PAAGASVDWAYGTQDVRMAFCYELRPSSTSYLTGFKLPAEQIVPASEELLDSIVAMATEV 423

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG8563NP_001261515.1 M14_CP_A-B_like 146..437 CDD:199844 95/306 (31%)
CG17633NP_609310.2 MpaA 7..374 CDD:225421 107/399 (27%)
Propep_M14 34..105 CDD:280416 13/95 (14%)
M14_CP_A-B_like 125..423 CDD:199844 95/306 (31%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C71186519
eggNOG 1 0.900 E1_COG2866
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 66 1.000 Inparanoid score I2432
Isobase 00.000 Not matched by this tool.
OrthoDB 1 1.010 D208397at33208
OrthoFinder 1 1.000 FOG0000073
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 P PTHR11705
RoundUp 00.000 Not matched by this tool.
65.990

Return to query results.
Submit another query.