DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment smid and AT5G67630

DIOPT Version :9

Sequence 1:NP_523959.2 Gene:smid / 38824 FlyBaseID:FBgn0016983 Length:944 Species:Drosophila melanogaster
Sequence 2:NP_201564.1 Gene:AT5G67630 / 836899 AraportID:AT5G67630 Length:469 Species:Arabidopsis thaliana


Alignment Length:319 Identity:66/319 - (20%)
Similarity:116/319 - (36%) Gaps:111/319 - (34%)


- Green bases have known domain annotations that are detailed below.


  Fly   644 MQPSAKREGFITVPDTTWDDIGA-------LEKIREELKLAVLAPVKYPEMLERLGLTAPSGVLL 701
            ::|.|..||.:       ..:.|       |:.|||                   |..|...:|:
plant    33 LEPRAVSEGMV-------GQVKARKAAGVILQMIRE-------------------GKIAGRAILI 71

  Fly   702 CGPPGCGKTLLAKAIANEAGIN--FISVKGPELMNMYVGESERAVRACFQRA----RNSAPCVIF 760
            .|.||.|||.:|..:|...|:.  |..:.|.|:.::.:.::| |:...|::|    ......||.
plant    72 AGQPGTGKTAIAMGMAKSLGLETPFAMIAGSEIFSLEMSKTE-ALTQSFRKAIGVRIKEETEVIE 135

  Fly   761 FDEFDSLCPKRSDGGDGNNSGTRIVNQLLTEMDGVEERKGVYILAATNRPDI-------IDPA-- 816
            .:..:....:.:..|..:.||.  :....|:|:.|.: .|..::.|.|:..:       ||.|  
plant   136 GEVVEVQIDRPASSGVASKSGK--MTMKTTDMETVYD-MGAKMIEALNKEKVQSGDVIAIDKATG 197

  Fly   817 -ILRPGR-------LDTI----LYVGFP--EQSERTEILKATTKNGKRPVLADDVDLDEIAAQTE 867
             |.:.||       .|.:    .:|..|  |..:|.|::...|.:          ::|.|.::|:
plant   198 KITKLGRSFSRSRDYDAMGAQTKFVQCPEGELQKRKEVVHCVTLH----------EIDVINSRTQ 252

  Fly   868 GYTGADLAGLVKQASMFSLRQSLNNGDTNLDDLCVRSQHFQEALQQLRPSVNEQ-DRKI 925
            |:.                  :|..|||.                ::|..|.|| |.|:
plant   253 GFL------------------ALFTGDTG----------------EIRSEVREQIDTKV 277

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
smidNP_523959.2 Nucleolin_bd 2..71 CDD:293330
SpoVK 271..919 CDD:223540 61/310 (20%)
AAA 287..418 CDD:278434
P-loop_NTPase 679..>716 CDD:304359 10/36 (28%)
AAA 699..830 CDD:278434 35/157 (22%)
AT5G67630NP_201564.1 TIP49 1..448 CDD:224145 66/319 (21%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.