DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment smid and rpt-3

DIOPT Version :9

Sequence 1:NP_523959.2 Gene:smid / 38824 FlyBaseID:FBgn0016983 Length:944 Species:Drosophila melanogaster
Sequence 2:NP_498429.1 Gene:rpt-3 / 175925 WormBaseID:WBGene00004503 Length:414 Species:Caenorhabditis elegans


Alignment Length:326 Identity:110/326 - (33%)
Similarity:181/326 - (55%) Gaps:31/326 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly   585 APEEPKK-------------AVEQE--VDSSSSNDEYYEPTLAELTNFLDNPPEEFADPNFCLTL 634
            |.||.|:             ||:|.  :..|::...||...|:.|...|..|....|...:...|
 Worm    71 AQEEVKRIQSVPLVIGQFLEAVDQNHAIVGSTTGSNYYVRVLSILDRELLKPGCSVALHKYSNAL 135

  Fly   635 IDFV-----DAIKVMQPSAKREGFITVPDTTWDDIGALEKIREELKLAVLAPVKYPEMLERLGLT 694
            :|.:     .:|::::|..|       ||.::.|||.|:..::|::.||..|:.:.|:.:::|:.
 Worm   136 VDVLPPEADSSIQMLRPDEK-------PDISYGDIGGLDMQKQEVREAVELPLTHGELYQQIGID 193

  Fly   695 APSGVLLCGPPGCGKTLLAKAIANEAGINFISVKGPELMNMYVGESERAVRACFQRARNSAPCVI 759
            .|.|||:.||||||||:||||:|.....:||.|.|.|.:..|:||..|.||..|:.|:.::|.:|
 Worm   194 PPRGVLMYGPPGCGKTMLAKAVAANTAASFIRVVGSEFVQKYLGEGPRMVRDVFRLAKENSPSII 258

  Fly   760 FFDEFDSLCPKRSDGGDG-NNSGTRIVNQLLTEMDGVEERKGVYILAATNRPDIIDPAILRPGRL 823
            |.||.|::..||.|...| :....||:.:||.:|||.::...|.::.||||.|.:|||:||||||
 Worm   259 FIDEIDAIATKRFDAQTGADREVQRILLELLNQMDGFDQSTNVKVIMATNRQDTLDPALLRPGRL 323

  Fly   824 DTILYVGFPEQSERTEILKATTKNGKRPVLADDVDLDEIAAQTEGYTGADLAGLVKQASMFSLRQ 888
            |..:....|::.::..:.....   .|..|:|||||::..|:.:..:|||:..:.::|.|.::|:
 Worm   324 DRKIEFPLPDRRQKRLVFSTVC---SRMNLSDDVDLEDWVARPDKISGADINSICQEAGMQAVRE 385

  Fly   889 S 889
            :
 Worm   386 N 386

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
smidNP_523959.2 Nucleolin_bd 2..71 CDD:293330
SpoVK 271..919 CDD:223540 110/326 (34%)
AAA 287..418 CDD:278434
P-loop_NTPase 679..>716 CDD:304359 18/36 (50%)
AAA 699..830 CDD:278434 61/131 (47%)
rpt-3NP_498429.1 PTZ00454 35..414 CDD:240423 110/326 (34%)
AAA 198..331 CDD:278434 61/132 (46%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.