DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: qm and BTS1

Sequence 1:NP_001163370.1 Gene:qm FlyBaseID:FBgn0019662 Length:338 Species:Drosophila melanogaster
Sequence 2:NP_015256.1 Gene:BTS1 SGDID:S000005990 Length:335 Species:Saccharomyces cerevisiae

Alignment Length:318 Identity:123/319 (39%)
Similarity:178/319 (56%) Gaps:27/319 (8%)


  Fly    13 DKSTQKEQDEILLQPFTYIQQIPGKQFRSELALAFNHWLLIPGEKLAQIGDIVQMLHNSSLLIDD 77
            |.....:.:.::.:|:.:|...|||.||..|.:..|..:.:|.::||.:..||::||||||||||
Yeast    12 DPVWSSQNESLISKPYNHILLKPGKNFRLNLIVQINRVMNLPKDQLAIVSQIVELLHNSSLLIDD 76

  Fly    78 IEDNSILRRGVPVAHSIYGVASTINAANYALFLALEKVQQLDHPE-----ATKVYTEQLLELHRG 137
            ||||:.||||...:|.|:||.||||.|||..|.|::.|.||...|     ...::.|:|:.||||
Yeast    77 IEDNAPLRRGQTTSHLIFGVPSTINTANYMYFRAMQLVSQLTTKEPLYHNLITIFNEELINLHRG 141

  Fly   138 QGMEIYWRDSF--TCPSESDYKLMTVRKTGGLFMLAIRLMQLFSSNKEDYSKLTA---ILGLYFQ 197
            ||::|||||..  ..|::..|..|.:.||||||.|.:|||:..|.:......|..   :||:.:|
Yeast   142 QGLDIYWRDFLPEIIPTQEMYLNMVMNKTGGLFRLTLRLMEALSPSSHHGHSLVPFINLLGIIYQ 206

  Fly   198 IRDDYCNLSLKEYTENKSFAEDLTEGKFGFPVIHAVRTQK------QDKQVLHILRQRTHDIEVK 256
            |||||.||...:.:..|.||||:||||..||::||:...|      |..::|.||..||.|.::|
Yeast   207 IRDDYLNLKDFQMSSEKGFAEDITEGKLSFPIVHALNFTKTKGQTEQHNEILRILLLRTSDKDIK 271

  Fly   257 KYCITLLE-KLGSFQYTRKVLESLDAEARSEVARLGSNPYMDRLLNKLLSWKTSDSAS 313
            ...|.:|| ...|..||:..:..|....:::    ..|.|:..|.:.      ||:|:
Yeast   272 LKLIQILEFDTNSLAYTKNFINQLVNMIKND----NENKYLPDLASH------SDTAT 319

Known Domains:


GeneSequenceDomainRegion External IDIdentity
qmNP_001163370.1 polyprenyl_synt 30..267 CDD:278763 111/254 (44%)
BTS1NP_015256.1 polyprenyl_synt 20..277 CDD:306784 110/257 (43%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C18743224
eggNOG 1 0.900 E1_COG0142
Hieranoid 1 1.000
Homologene 1 1.000 H31267
Inparanoid 1 1.050 208 1.000 Inparanoid score I811
Isobase 1 0.950 0 Normalized mean entropy S1150
OMA 1 1.010
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 FOG0006288
OrthoInspector 1 1.000 T1136640
orthoMCL 1 0.900 OOG5_129071
Panther 1 1.100 LDO PTHR12001
Phylome 1 0.910 0.667 Consistency score
RoundUp 1 1.030 avgDist Average_Evolutionary_Distance R2131
TreeFam 1 0.960
1413.740

Return to query results.
Submit another query.