DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: qm and GGPS2

Sequence 1:NP_001163370.1 Gene:qm FlyBaseID:FBgn0019662 Length:338 Species:Drosophila melanogaster
Sequence 2:NP_179960.1 Gene:GGPS2 AraportID:AT2G23800 Length:376 Species:Arabidopsis thaliana

Alignment Length:266 Identity:67/267 (25%)
Similarity:103/267 (39%) Gaps:54/267 (20%)


  Fly    11 TKDKSTQKEQDEI--------LLQPFTYIQQIPGKQFRSELALAFNHWLLIPGEKLAQI--GDIV 65
            :|.:|..|..:|.        :.:...|.....||:.|..|.||...  |:.|::.|.:  ...|
plant    91 SKAESVNKALEEAIPVGEPLKIHEAMRYAILAAGKRVRPILCLASCE--LVGGQENAAMPAACAV 153

  Fly    66 QMLHNSSLLIDDIE--DNSILRRGVPVAHSIYGVASTINAANYALFLALEKVQQLDHPEATKVYT 128
            :|:|..||:.||:.  ||..||||.|..|.:||....|.:....|.||.|      |....::.:
plant   154 EMIHTMSLIKDDLPCMDNDDLRRGKPTTHKVYGEGVAILSGGALLSLAFE------HMTTAEISS 212

  Fly   129 EQLL----ELHR---------GQGMEIYWRDSFTCPSE---------SDYKLMTVRKTGGLFMLA 171
            |:::    ||.|         ||.|:|        .||         ...:.:.|.||..|...|
plant   213 ERMVWAVRELARSIGTRGLVAGQAMDI--------SSEGLDLNEVGLEHLEFIHVHKTAVLLETA 269

  Fly   172 IRLMQLFSSNK----EDYSKLTAILGLYFQIRDDYCNLSLKEYTENKSFAEDLTEGKFGFPVIHA 232
            ..|..:.....    |...|....:||.||:.||..:.:.......|:..:|...||..:|.:..
plant   270 AVLGAIIGGGSDEEIESVRKFARCIGLLFQVVDDILDETKSSEELGKTAGKDQLAGKLTYPKLIG 334

  Fly   233 VRTQKQ 238
            :...|:
plant   335 LEKSKE 340

Known Domains:


GeneSequenceDomainRegion External IDIdentity
qmNP_001163370.1 polyprenyl_synt 30..267 CDD:278763 63/240 (26%)
GGPS2NP_179960.1 Trans_IPPS_HT 112..374 CDD:173833 63/246 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 D981769at2759
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.