DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment MED4 and Med4

DIOPT Version :9

Sequence 1:NP_648094.1 Gene:MED4 / 38799 FlyBaseID:FBgn0035754 Length:258 Species:Drosophila melanogaster
Sequence 2:NP_080395.1 Gene:Med4 / 67381 MGIID:1914631 Length:270 Species:Mus musculus


Alignment Length:261 Identity:113/261 - (43%)
Similarity:166/261 - (63%) Gaps:30/261 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly     6 STKERLLLLIDDIEMIAKELIE----QAHQKISSTELVD-LLDLLVAKDEEFRKMLELAEEQAKV 65
            ||:||||..::|:|::::||||    ..:||:...|..: :|:||:.:|.:|:::::||..|.||
Mouse    25 STRERLLSALEDLEVLSRELIEMLAISRNQKLLQLEEENQVLELLIHRDGDFQELMKLALNQGKV 89

  Fly    66 EEAMDQLRAKVEVHDREIQKLQKSLKDAELILSTAIFQARQKLASINQANKRPVSSEELIKYAHR 130
            ...|..|..:||..|.:||:|||.||:||.||:||::||::||.||.:|.|..:||||:||||||
Mouse    90 HHEMQALEKEVEKRDSDIQQLQKQLKEAEQILATAVYQAKEKLKSIEKARKGAISSEEIIKYAHR 154

  Fly   131 ISSANAVSAPLTWCIGDLRRPYPTDIEMRNGLLGKSEQNINGGTVTHQNSGMPSEQQRTLSGSAG 195
            ||::|||.|||||..||.|||||||:|||:||||:    :|..:.:..|..:|.:          
Mouse   155 ISASNAVCAPLTWVPGDPRRPYPTDLEMRSGLLGQ----MNNPSTSGVNGHLPGD---------- 205

  Fly   196 SGSGSGAGGEVPNAFQNQFNWNLGELHMTMGASGNT--VALE-----TRAQDDVEVMSTDSSSSS 253
                :.|.|.:|:....|:.|...::.:.|....::  ..||     ...:||||||||||||||
Mouse   206 ----ALAAGRLPDVLAPQYPWQSNDMSVNMLPPNHSSDFLLEPPGHNKENEDDVEVMSTDSSSSS 266

  Fly   254 S 254
            |
Mouse   267 S 267

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
MED4NP_648094.1 Med4 47..189 CDD:401849 72/141 (51%)
Med4NP_080395.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..21
Med4 64..>189 CDD:401849 71/124 (57%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 227..270 18/41 (44%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Software error:

Can't use an undefined value as an ARRAY reference at /www/www.flyrnai.org/docroot/cgi-bin/DRSC_prot_align.pl line 1034.

For help, please send mail to the webmaster (ritg@hms.harvard.edu), giving this error message and the time and date of the error.

Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - -
Domainoid 1 1.000 - -
eggNOG 1 0.900 - -
Hieranoid 1 1.000 - -