powered by:
Protein Alignment MED4 and Mmachc
DIOPT Version :9
Sequence 1: | NP_648094.1 |
Gene: | MED4 / 38799 |
FlyBaseID: | FBgn0035754 |
Length: | 258 |
Species: | Drosophila melanogaster |
Sequence 2: | NP_080238.2 |
Gene: | Mmachc / 67096 |
MGIID: | 1914346 |
Length: | 279 |
Species: | Mus musculus |
Alignment Length: | 43 |
Identity: | 11/43 - (25%) |
Similarity: | 18/43 - (41%) |
Gaps: | 10/43 - (23%) |
- Green bases have known domain annotations that are detailed below.
Fly 82 EIQKLQKSLKDAELILSTAIFQARQKLASINQANKRPVSSEEL 124
|.||:..|...|: |..|..:.|.::.|.::.||
Mouse 217 EEQKIYFSTPPAQ----------RLALLGLAQPSEHPSTTSEL 249
|
Known Domains:
Indicated by green bases in alignment.
Information from Original Tools:
Tool |
Simple Score |
Weighted Score |
Original Tool Information |
BLAST Result |
Score |
Score Type |
Cluster ID |
Compara |
0 | 0.000 |
Not matched by this tool. |
Domainoid |
0 | 0.000 |
Not matched by this tool. |
eggNOG |
1 |
0.900 |
- |
- |
|
E1_KOG4552 |
Hieranoid |
0 | 0.000 |
Not matched by this tool. |
Homologene |
0 | 0.000 |
Not matched by this tool. |
Inparanoid |
0 | 0.000 |
Not matched by this tool. |
Isobase |
0 | 0.000 |
Not matched by this tool. |
OMA |
0 | 0.000 |
Not matched by this tool. |
OrthoDB |
0 | 0.000 |
Not matched by this tool. |
OrthoFinder |
0 | 0.000 |
Not matched by this tool. |
OrthoInspector |
0 | 0.000 |
Not matched by this tool. |
orthoMCL |
0 | 0.000 |
Not matched by this tool. |
Panther |
0 | 0.000 |
Not matched by this tool. |
Phylome |
0 | 0.000 |
Not matched by this tool. |
RoundUp |
0 | 0.000 |
Not matched by this tool. |
SonicParanoid |
0 | 0.000 |
Not matched by this tool. |
SwiftOrtho |
0 | 0.000 |
Not matched by this tool. |
TreeFam |
0 | 0.000 |
Not matched by this tool. |
|
1 | 0.900 |
|
Return to query results.
Submit another query.