DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment MED4 and Mmachc

DIOPT Version :9

Sequence 1:NP_648094.1 Gene:MED4 / 38799 FlyBaseID:FBgn0035754 Length:258 Species:Drosophila melanogaster
Sequence 2:NP_080238.2 Gene:Mmachc / 67096 MGIID:1914346 Length:279 Species:Mus musculus


Alignment Length:43 Identity:11/43 - (25%)
Similarity:18/43 - (41%) Gaps:10/43 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly    82 EIQKLQKSLKDAELILSTAIFQARQKLASINQANKRPVSSEEL 124
            |.||:..|...|:          |..|..:.|.::.|.::.||
Mouse   217 EEQKIYFSTPPAQ----------RLALLGLAQPSEHPSTTSEL 249

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
MED4NP_648094.1 Med4 47..189 CDD:287038 11/43 (26%)
MmachcNP_080238.2 MMACHC 20..234 CDD:293295 6/26 (23%)
Substrate binding. /evidence=ECO:0000250|UniProtKB:Q9Y4U1 115..118
Substrate binding. /evidence=ECO:0000250|UniProtKB:Q9Y4U1 129..131
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 239..279 3/11 (27%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG4552
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.