DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: MED4 and zgc:123294

Sequence 1:NP_648094.1 Gene:MED4 FlyBaseID:FBgn0035754 Length:258 Species:Drosophila melanogaster
Sequence 2:NP_001032512.1 Gene:zgc:123294 ZFINID:ZDB-GENE-051120-42 Length:227 Species:Danio rerio

Alignment Length:263 Identity:101/264 (38%)
Similarity:154/264 (58%) Gaps:47/264 (18%)


  Fly     5 LSTKERLLLLIDDIEMIAKELIE-QAHQKISSTELV-DLLDLLVAKDEEFRKMLELAEEQAKVEE 67
            ::||.:|:..:||.|::.||||| ...|:.:.|:.: :::|.::..|...:::||.||||.:|.:
Zfish     1 MATKFQLVRSLDDFELLVKELIEVVTSQRANRTQSIKEIVDTMLFLDNNMKQLLEKAEEQVEVHQ 65

  Fly    68 AMDQLRAKVEVHDREIQKLQKSLKDAELILSTAIFQARQKLASINQANKRPVSSEELIKYAHRIS 132
            .:..|:|::...|:...:|||.|.|||.:|:|.::||:|||.|||:|:|:|||.|:|:|.|||||
Zfish    66 KVIALQAEINQMDKLTNELQKQLSDAEQLLATVVYQAKQKLESINKADKKPVSFEDLVKLAHRIS 130

  Fly   133 SANAVSAPLTWCIGDLRRPYPTDIEMRNGLL-------GKSEQNINGGTVTHQNSGMPSEQQRTL 190
            ::|.|.|||.|..||||||||||.:|::|||       |.|.|.:             :|..|..
Zfish   131 ASNGVCAPLAWKTGDLRRPYPTDKDMKSGLLFRMGDYSGNSSQGV-------------TEFVRND 182

  Fly   191 SG-SAGSGSGSGAGGEVPNAFQNQFNWNLGELHMTMGASGNTVALETRAQDDVEVMSTDSSSSSS 254
            |. .||:                 ::|.....|: :|.|.|.:    :.|:|.|  |:||||||.
Zfish   183 SAIEAGT-----------------YSWFSSTPHI-VGGSSNVM----QRQEDGE--SSDSSSSSD 223

  Fly   255 SDS 257
            |||
Zfish   224 SDS 226

Known Domains:


GeneSequenceDomainRegion External IDIdentity
MED4NP_648094.1 Med4 47..189 CDD:287038 66/149 (44%)
zgc:123294NP_001032512.1 Med4 46..>163 CDD:287038 61/117 (52%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 FOG0005197
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 0.714 Consistency score
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.