DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: MED4 and med4

Sequence 1:NP_648094.1 Gene:MED4 FlyBaseID:FBgn0035754 Length:258 Species:Drosophila melanogaster
Sequence 2:NP_001017883.1 Gene:med4 ZFINID:ZDB-GENE-050417-438 Length:254 Species:Danio rerio

Alignment Length:264 Identity:116/265 (44%)
Similarity:164/265 (62%) Gaps:36/265 (14%)


  Fly     6 STKERLLLLIDDIEMIAKELIE----QAHQKISST-ELVDLLDLLVAKDEEFRKMLELAEEQAKV 65
            |||||||..:||:|::::||||    ...||:... |...:|:||:.:|:||:::::.|.||.:|
Zfish     9 STKERLLSTLDDLEVLSRELIEMLALSRSQKLPPPGEDTLILELLIQRDKEFQELMQTALEQGRV 73

  Fly    66 EEAMDQLRAKVEVHDREIQKLQKSLKDAELILSTAIFQARQKLASINQANKRPVSSEELIKYAHR 130
            .:.|..|..:||..|.:||:|||.||:||.||:||::||::||.||::|.|..:||:|:||||||
Zfish    74 HQEMQSLEKEVEKRDSDIQQLQKQLKEAEHILATAVYQAKEKLKSIDKARKGSISSKEIIKYAHR 138

  Fly   131 ISSANAVSAPLTWCIGDLRRPYPTDIEMRNGLLGK-SEQNINGGTVTHQNSGMPSEQQRTLSGSA 194
            ||::|||.|||.|..||.|||||||:|||:|:||. |..:.||     .|..:|.:         
Zfish   139 ISASNAVCAPLNWVPGDPRRPYPTDLEMRSGMLGNMSNMSTNG-----VNGHLPGD--------- 189

  Fly   195 GSGSGSGAGGEVPNAFQNQFNWNLGELHMTMGA----SGNTVALE-----TRAQDDVEVMSTDSS 250
                 :.|.|.:|:....|:.|.  ...::||.    .||...||     ...:||||.||||||
Zfish   190 -----ALAAGRLPDVLTPQYPWQ--STDVSMGILPPHHGNDFGLEPPGHNKENEDDVEAMSTDSS 247

  Fly   251 SSSS 254
            ||||
Zfish   248 SSSS 251

Known Domains:


GeneSequenceDomainRegion External IDIdentity
MED4NP_648094.1 Med4 47..189 CDD:287038 71/143 (50%)
med4NP_001017883.1 Med4 49..>186 CDD:287038 73/142 (51%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C235035751
eggNOG 1 0.900 E1_KOG4552
Hieranoid 1 1.000
Homologene 1 1.000 H8568
Inparanoid 1 1.050 189 1.000 Inparanoid score I3814
OMA 1 1.010
OrthoDB 1 1.010 D1333917at2759
OrthoFinder 1 1.000 FOG0005197
OrthoInspector 1 1.000 T1054020
orthoMCL 1 0.900 OOG5_132387
Panther 1 1.100 LDO PTHR13208
Phylome 1 0.910 0.667 Consistency score
RoundUp 00.000 Not matched by this tool.
TreeFam 1 0.960
ZFIN 00.000 Not matched by this tool.
1312.770

Return to query results.
Submit another query.