DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: MED4 and mmachc

Sequence 1:NP_648094.1 Gene:MED4 FlyBaseID:FBgn0035754 Length:258 Species:Drosophila melanogaster
Sequence 2:XP_012816600.1 Gene:mmachc XenbaseID:XB-GENE-963487 Length:245 Species:Xenopus tropicalis

Alignment Length:61 Identity:11/62 (18%)
Similarity:26/62 (42%) Gaps:15/62 (24%)


  Fly   140 PLTWCIGD----LRRPYPT-------DIEM----RNGLLGKSEQNINGGTVTHQNSGMPSE 185
            |:..|:..    ::..||:       |.|:    |..:|.::..:::|....:|...:|.:
 Frog    77 PIDQCVAYHMSLVKEKYPSGKLDVIYDYELHPNRRPKVLMQTAAHVSGAAYYYQRKDIPQD 137

Known Domains:


GeneSequenceDomainRegion External IDIdentity
MED4NP_648094.1 Med4 47..189 CDD:287038 11/62 (18%)
mmachcXP_012816600.1 MMACHC 19..233 CDD:293295 11/62 (18%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_KOG4552
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.