DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: MED4 and med4

Sequence 1:NP_648094.1 Gene:MED4 FlyBaseID:FBgn0035754 Length:258 Species:Drosophila melanogaster
Sequence 2:NP_001011218.1 Gene:med4 XenbaseID:XB-GENE-972352 Length:252 Species:Xenopus tropicalis

Alignment Length:262 Identity:119/263 (45%)
Similarity:167/263 (63%) Gaps:32/263 (12%)


  Fly     6 STKERLLLLIDDIEMIAKELIE----QAHQKISST-ELVDLLDLLVAKDEEFRKMLELAEEQAKV 65
            ||||||:..:||:|::::||||    ..:||:|.. |...:|:||:.||.||::::::|..|.|:
 Frog     7 STKERLMSFLDDLEVLSRELIEMLALSRNQKLSQPGEENQILELLIQKDGEFQELMKVALSQGKI 71

  Fly    66 EEAMDQLRAKVEVHDREIQKLQKSLKDAELILSTAIFQARQKLASINQANKRPVSSEELIKYAHR 130
            .:.|..|..:||..|.:||:|||.||:||.||:||::||::||.||::|.|..:|||||||||||
 Frog    72 HQEMQVLEKEVEKRDSDIQQLQKQLKEAEHILATAVYQAKEKLKSIDKARKGAISSEELIKYAHR 136

  Fly   131 ISSANAVSAPLTWCIGDLRRPYPTDIEMRNGLLGKSEQNINGGTVTHQNSGMPSEQQRTLSGSAG 195
            ||::|||.|||||..||.|||||||:|||:||||             |.|.:|:      :|..|
 Frog   137 ISASNAVCAPLTWVPGDPRRPYPTDLEMRSGLLG-------------QMSNLPT------NGVNG 182

  Fly   196 SGSGSG-AGGEVPNAFQNQFNWNLGELHMTM--GASGNTVALET-----RAQDDVEVMSTDSSSS 252
            ...|.. |.|.:|:....|:.|...::.|.|  ....|...:|:     ..::||||||||||||
 Frog   183 HLPGDALAAGRLPDVLAPQYPWQSNDMSMNMLPPNHSNEFLMESLGPNKENEEDVEVMSTDSSSS 247

  Fly   253 SS 254
            ||
 Frog   248 SS 249

Known Domains:


GeneSequenceDomainRegion External IDIdentity
MED4NP_648094.1 Med4 47..189 CDD:287038 73/142 (51%)
med4NP_001011218.1 Med4 46..>173 CDD:287038 74/140 (53%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C235037494
eggNOG 1 0.900 E1_KOG4552
Hieranoid 1 1.000
Homologene 1 1.000 H8568
Inparanoid 1 1.050 197 1.000 Inparanoid score I3598
OMA 1 1.010
OrthoDB 1 1.010 D1333917at2759
OrthoFinder 1 1.000 FOG0005197
OrthoInspector 1 1.000 T1060813
Phylome 1 0.910 0.667 Consistency score
RoundUp 1 1.030 avgDist Average_Evolutionary_Distance R2637
TreeFam 1 0.960
1211.800

Return to query results.
Submit another query.