powered by:
Protein Alignment MED4 and cblc-1
DIOPT Version :9
Sequence 1: | NP_648094.1 |
Gene: | MED4 / 38799 |
FlyBaseID: | FBgn0035754 |
Length: | 258 |
Species: | Drosophila melanogaster |
Sequence 2: | NP_001022524.1 |
Gene: | cblc-1 / 3565644 |
WormBaseID: | WBGene00022766 |
Length: | 272 |
Species: | Caenorhabditis elegans |
Alignment Length: | 64 |
Identity: | 15/64 - (23%) |
Similarity: | 28/64 - (43%) |
Gaps: | 10/64 - (15%) |
- Green bases have known domain annotations that are detailed below.
Fly 137 VSAPLTWCIGDLRRPYPTDIEMRNGLLGKSEQNINGGTVTHQNSGMPSEQQRTLSGSAGSGSGS 200
||:|:...:.| .:|:.:..|.|.|:|.. :.|..|..|..:.:.|..:.|..:|:
Worm 90 VSSPIQSFLED-------RLEIMSEKLRKVEENFE---ILHDYSMTPQRRPKILMQTCGHVAGA 143
|
Known Domains:
Indicated by green bases in alignment.
Gene | Sequence | Domain | Region |
External ID | Identity |
MED4 | NP_648094.1 |
Med4 |
47..189 |
CDD:287038 |
12/51 (24%) |
cblc-1 | NP_001022524.1 |
MMACHC |
24..260 |
CDD:293295 |
15/64 (23%) |
Information from Original Tools:
Tool |
Simple Score |
Weighted Score |
Original Tool Information |
BLAST Result |
Score |
Score Type |
Cluster ID |
Compara |
0 | 0.000 |
Not matched by this tool. |
Domainoid |
0 | 0.000 |
Not matched by this tool. |
eggNOG |
1 |
0.900 |
- |
- |
|
E1_KOG4552 |
Hieranoid |
0 | 0.000 |
Not matched by this tool. |
Homologene |
0 | 0.000 |
Not matched by this tool. |
Inparanoid |
0 | 0.000 |
Not matched by this tool. |
Isobase |
0 | 0.000 |
Not matched by this tool. |
OMA |
0 | 0.000 |
Not matched by this tool. |
OrthoDB |
0 | 0.000 |
Not matched by this tool. |
OrthoFinder |
0 | 0.000 |
Not matched by this tool. |
OrthoInspector |
0 | 0.000 |
Not matched by this tool. |
orthoMCL |
0 | 0.000 |
Not matched by this tool. |
Panther |
0 | 0.000 |
Not matched by this tool. |
Phylome |
0 | 0.000 |
Not matched by this tool. |
RoundUp |
0 | 0.000 |
Not matched by this tool. |
SonicParanoid |
0 | 0.000 |
Not matched by this tool. |
SwiftOrtho |
0 | 0.000 |
Not matched by this tool. |
TreeFam |
0 | 0.000 |
Not matched by this tool. |
|
1 | 0.900 |
|
Return to query results.
Submit another query.