DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: MED4 and Med4

Sequence 1:NP_648094.1 Gene:MED4 FlyBaseID:FBgn0035754 Length:258 Species:Drosophila melanogaster
Sequence 2:NP_001019427.1 Gene:Med4 RGDID:1306671 Length:270 Species:Rattus norvegicus

Alignment Length:261 Identity:113/262 (43%)
Similarity:166/262 (63%) Gaps:30/262 (11%)


  Fly     6 STKERLLLLIDDIEMIAKELIE----QAHQKISSTELVD-LLDLLVAKDEEFRKMLELAEEQAKV 65
            ||:||||..::|:|::::||||    ..:||:...|..: :|:||:.:|.:|:::::||..|.||
  Rat    25 STRERLLSALEDLEVLSRELIEMLAISRNQKLLQLEEENQVLELLIHRDGDFQELMKLALNQGKV 89

  Fly    66 EEAMDQLRAKVEVHDREIQKLQKSLKDAELILSTAIFQARQKLASINQANKRPVSSEELIKYAHR 130
            ...|..|..:||..|.:||:|||.||:||.||:||::||::||.||.:|.|..:||||:||||||
  Rat    90 HHEMQALEKEVEKRDSDIQQLQKQLKEAEQILATAVYQAKEKLKSIEKARKGAISSEEIIKYAHR 154

  Fly   131 ISSANAVSAPLTWCIGDLRRPYPTDIEMRNGLLGKSEQNINGGTVTHQNSGMPSEQQRTLSGSAG 195
            ||::|||.|||||..||.|||||||:|||:||||:    :|..:.:..|..:|.:          
  Rat   155 ISASNAVCAPLTWVPGDPRRPYPTDLEMRSGLLGQ----MNNPSTSGVNGHLPGD---------- 205

  Fly   196 SGSGSGAGGEVPNAFQNQFNWNLGELHMTMGASGNTV--ALE-----TRAQDDVEVMSTDSSSSS 253
                :.|.|.:|:....|:.|...::.:.|....::.  .||     ...:||||||||||||||
  Rat   206 ----ALAAGRLPDVLAPQYPWQSNDMSVNMLPPNHSTDFLLEPPGHNKENEDDVEVMSTDSSSSS 266

  Fly   254 S 254
            |
  Rat   267 S 267

Known Domains:


GeneSequenceDomainRegion External IDIdentity
MED4NP_648094.1 Med4 47..189 CDD:287038 72/142 (51%)
Med4NP_001019427.1 Med4 64..>202 CDD:287038 74/142 (52%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C235030380
eggNOG 1 0.900 E1_KOG4552
Hieranoid 1 1.000
Homologene 1 1.000 H8568
Inparanoid 1 1.050 191 1.000 Inparanoid score I3739
OMA 1 1.010
OrthoDB 1 1.010 D1333917at2759
OrthoFinder 1 1.000 FOG0005197
OrthoInspector 1 1.000 T1088401
orthoMCL 1 0.900 OOG5_132387
Panther 1 1.100 LDO PTHR13208
Phylome 1 0.910 0.667 Consistency score
TreeFam 1 0.960
1312.770

Return to query results.
Submit another query.