DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: MED4 and pmc4

Sequence 1:NP_648094.1 Gene:MED4 FlyBaseID:FBgn0035754 Length:258 Species:Drosophila melanogaster
Sequence 2:NP_596462.1 Gene:pmc4 PomBaseID:SPBC1105.06 Length:239 Species:Schizosaccharomyces pombe

Alignment Length:162 Identity:28/163 (17%)
Similarity:70/163 (43%) Gaps:30/163 (18%)


  Fly    15 IDDIEMIAKELIEQAHQKISSTELVDLLDLLVAKDEEFRKMLELAEEQAKVEEAMDQLRAKVEVH 79
            ||.||....:.:..:.:|:....|::....||.   ..:.:..|........|..:::.:.:: .
pombe     7 IDSIEECLNKQLRLSSEKVDQYVLIENWTSLVG---HLKTLHSLISNYTNGRELQNEISSLLK-Q 67

  Fly    80 DREIQ-KLQKSLKDAELILSTAIFQARQKLASINQANKRPVSSEELIKYAHRISSANA------- 136
            |:|:. ::|..:::...|..|.:.:      :::...::.|::|.|:.|..::|..::       
pombe    68 DKELDLQIQDCMREMTSIYDTHLPK------TVSGRKRQKVNAETLLDYGRKLSKFSSAPPGYNP 126

  Fly   137 -----VSAPLTWCIGDLRRPYPTDIEMRNGLL 163
                 ..||:.:       |:|::.:||..||
pombe   127 ETGQDAKAPVHY-------PWPSEDQMRKTLL 151

Known Domains:


GeneSequenceDomainRegion External IDIdentity
MED4NP_648094.1 Med4 47..189 CDD:287038 20/131 (15%)
pmc4NP_596462.1 Med4 41..>153 CDD:287038 20/126 (16%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 LDO PTHR13208
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.