DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: MED4 and mdt-4

Sequence 1:NP_648094.1 Gene:MED4 FlyBaseID:FBgn0035754 Length:258 Species:Drosophila melanogaster
Sequence 2:NP_494905.2 Gene:mdt-4 WormBaseID:WBGene00007012 Length:334 Species:Caenorhabditis elegans

Alignment Length:328 Identity:103/329 (31%)
Similarity:145/329 (44%) Gaps:87/329 (26%)


  Fly     6 STKERLLLLIDDIEMIAKELIEQAHQKISSTEL------VDLLDLLVAKDEEFRKMLELAEEQAK 64
            |.::.||...||:|.|.|.:::....:..|..|      .:::.|..:|.:..:.:|:...|..:
 Worm     8 SLRDLLLESADDLEHIVKMIVDTLINRDKSVMLKNGETVTNIIKLFDSKQDSIKTLLKRVPEFQE 72

  Fly    65 VEEAMDQLRAKVEVHDREIQKLQKSLKDAELILSTAIFQARQKLASINQANKRPVSSEELIKYAH 129
            .|:.:..|.|.||..|..||:|:.:||..|:.|:.:.|.|.|||..:.:|..|||:||.|||.||
 Worm    73 REQLIRTLEAHVEKRDEVIQQLETNLKSCEVALTRSCFHANQKLKQMKEAELRPVNSEMLIKLAH 137

  Fly   130 RISSANAVSAPLTWCIGDLRRPYPTDIEMRNG--------------LLGK-----------SEQN 169
            :||..|:|||||||.:||..||:|.:.|.|.|              |.||           |..:
 Worm   138 QISKHNSVSAPLTWQMGDPSRPFPQEHEFRAGHLLNSKVQSTGPQLLPGKNVAQRPLITSPSASS 202

  Fly   170 INGGTVTHQNSGMPSEQQRTLSGSAGSGSGS---GAGGEVPNAFQ---------NQFNWNLGELH 222
            .||||...:..|.|      |..||.:|..|   |.|.:.|...|         |:..|      
 Worm   203 SNGGTAPIRTVGTP------LINSAPTGDFSPRTGFGTDEPPPIQQQVLRGATPNEKQW------ 255

  Fly   223 MTMGASGNT------------------VALE-----------TRAQD--DVEVMSTDSSSSS-SS 255
            ...|.||.|                  |.|:           .:.||  |||.||:|||:|| ||
 Worm   256 QNPGVSGATSTQSPYNRVSQSPSSSPNVKLKITGLPNRPGGIDQVQDVRDVEQMSSDSSNSSDSS 320

  Fly   256 DSQ 258
            |.:
 Worm   321 DDE 323

Known Domains:


GeneSequenceDomainRegion External IDIdentity
MED4NP_648094.1 Med4 47..189 CDD:287038 60/167 (36%)
mdt-4NP_494905.2 Med4 47..247 CDD:287038 70/206 (34%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C234323444
eggNOG 1 0.900 E1_KOG4552
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 107 1.000 Inparanoid score I3455
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 D1333917at2759
OrthoFinder 1 1.000 FOG0005197
OrthoInspector 1 1.000 T477317
orthoMCL 1 0.900 OOG5_132387
Panther 1 1.100 LDO PTHR13208
Phylome 1 0.910 0.667 Consistency score
RoundUp 1 1.030 avgDist Average_Evolutionary_Distance R2637
TreeFam 00.000 Not matched by this tool.
109.830

Return to query results.
Submit another query.