| Sequence 1: | NP_001261502.1 | Gene: | Neos / 38795 | FlyBaseID: | FBgn0024542 | Length: | 371 | Species: | Drosophila melanogaster | 
|---|---|---|---|---|---|---|---|---|---|
| Sequence 2: | XP_005166217.1 | Gene: | ncoa5 / 447849 | ZFINID: | ZDB-GENE-040912-155 | Length: | 622 | Species: | Danio rerio | 
| Alignment Length: | 476 | Identity: | 99/476 - (20%) | 
|---|---|---|---|
| Similarity: | 181/476 - (38%) | Gaps: | 161/476 - (33%) | 
- Green bases have known domain annotations that are detailed below.
| 
  Fly    12 TKDPALAKSRIFLGNLPVC--TREELVSICQPYGKVLGSMVQKNYGFVQFETEELANKAASALHK 74 
  Fly    75 STFKQNMLTVRNASIK--SKAANAIAKRNSNQGGQVTV-----------------QGGLVMSAAA 120 
  Fly   121 -------------------------AAAGQPLIN------------------------------- 129 
  Fly   130 --------------------------------------DCEIIVQNRENTKYAEYIEERLKNSSL 156 
  Fly   157 RVDVLFPNEDVLLGKVLANISSRGCLYAVLVTPQHEEHNSITVNILYGVPAEHRNMPLEDAITLI 221 
  Fly   222 STDFRL------KKQRD-----AVVLPPSTSIHKGQRR-HPQEMQGLLERLADNHPLTASQYEVI 274 
  Fly   275 LKYLEGEREEQLK--REVGEANALAKLKAPDP--------------------------------E 305 
  Fly   306 IELQKKILSIMNKPAVTDVTS 326 | 
| Gene | Sequence | Domain | Region | External ID | Identity | 
|---|---|---|---|---|---|
| Neos | NP_001261502.1 | U2AF_lg | <19..149 | CDD:273727 | 39/244 (16%) | 
| RRM_SF | 20..78 | CDD:388407 | 21/59 (36%) | ||
| ncoa5 | XP_005166217.1 | RRM | <1..168 | CDD:223796 | 32/148 (22%) | 
| RRM_hnRNPC_like | 27..94 | CDD:240787 | 22/66 (33%) | 
| Tool | Simple Score | Weighted Score | Original Tool Information | |||
|---|---|---|---|---|---|---|
| BLAST Result | Score | Score Type | Cluster ID | |||
| Compara | 1 | 0.930 | - | - | C170592100 | |
| Domainoid | 0 | 0.000 | Not matched by this tool. | |||
| eggNOG | 0 | 0.000 | Not matched by this tool. | |||
| Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
| Homologene | 0 | 0.000 | Not matched by this tool. | |||
| Inparanoid | 1 | 1.050 | 97 | 1.000 | Inparanoid score | I5029 | 
| OMA | 0 | 0.000 | Not matched by this tool. | |||
| OrthoDB | 1 | 1.010 | - | - | D421126at33208 | |
| OrthoFinder | 1 | 1.000 | - | - | FOG0006056 | |
| OrthoInspector | 1 | 1.000 | - | - | oto40048 | |
| orthoMCL | 1 | 0.900 | - | - | OOG6_109699 | |
| Panther | 1 | 1.100 | - | - | LDO | PTHR23295 | 
| Phylome | 1 | 0.910 | - | - | ||
| RoundUp | 1 | 1.030 | - | avgDist | Average_Evolutionary_Distance | R5288 | 
| SonicParanoid | 1 | 1.000 | - | - | X5759 | |
| SwiftOrtho | 1 | 1.000 | - | - | ||
| TreeFam | 0 | 0.000 | Not matched by this tool. | |||
| ZFIN | 0 | 0.000 | Not matched by this tool. | |||
| 11 | 10.930 | |||||