DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Neos and ncoa5

DIOPT Version :8

Sequence 1:NP_001261502.1 Gene:Neos / 38795 FlyBaseID:FBgn0024542 Length:371 Species:Drosophila melanogaster
Sequence 2:XP_005166217.1 Gene:ncoa5 / 447849 ZFINID:ZDB-GENE-040912-155 Length:622 Species:Danio rerio

Alignment Length:476 Identity:99/477 (21%)
Similarity:181/477 (38%) Gaps:161/477 (34%)


  Fly    12 TKDPALAKSRIFLGNLPVC--TREELVSICQPYGKVLGSMVQKNYGFVQFETEELANKAASALHK 74
            :.||...:.|||:||||..  .::::..:.:||||:....:.:.|||||||..|.|..|.:..:.
Zfish    19 SNDPRDLERRIFVGNLPTAHMAKKDMEDLFRPYGKIQALSLFRGYGFVQFERLEDAEAAKAGHNG 83

  Fly    75 STFKQNMLTVRNASIK--SKAANAIAKRNSNQGGQVTV-----------------QGGLVMSAAA 120
            ..::...|.|..|:.:  :|:.::..:|.|:..|:...                 :....|.|::
Zfish    84 RVYRGYKLDVNMAAERRQNKSRSSPPRRPSSSYGESREPRPRSRSPVHARDSRYHRESREMRASS 148

  Fly   121 -------------------------AAAGQPLIN------------------------------- 129
                                     :...:|.:.                               
Zfish   149 RESRPSSTREHEDRPPAEERYRGSESREKEPSLREEGYDRYYRGDYDYYRKKDEAYSDRYRDPWN 213

  Fly   130 --------------------------------------DCEIIVQNRENTKYAEYIEERLKNSSL 156
                                                  ||.:||.|:...:|||.:..::::..:
Zfish   214 GRREPEEERIRPEERRRNELYRQYYEELQKRYDIERPVDCSVIVVNKLQKEYAETVGRKVRDLGM 278

  Fly   157 RVDVLFPNEDVLLGKVLANISSRGCLYAVLVTPQHEEHNSITVNILYGVPAEHRNMPLEDAITLI 221
            .||::|.|.:|.|.:.|.::|.....:|:::|.||:.|.|.|||||:|.|.||||||::||:.|:
Zfish   279 VVDLIFLNTEVSLTQALEDVSRARTPFAIIITQQHQVHRSCTVNILFGTPQEHRNMPIQDAMVLV 343

  Fly   222 STDFRL------KKQRD-----AVVLPPSTSIHKGQRR-HPQEMQGLLERLADNHPLTASQYEVI 274
            :.:|..      .|:||     |..:.....:.:.:|. ||..:...:..|::...:|..:...:
Zfish   344 AHNFETFKVEHRAKERDEIARKAAKMADDVLMREHEREGHPVSVLTAITLLSEGRFMTPEELARL 408

  Fly   275 LKYLEGEREEQLK--REVGEANALAKLKAPDP--------------------------------E 305
            ::||..:|:..::  .:.|...:.|.|:...|                                :
Zfish   409 IEYLRDKRDRLVRSTTDAGPHPSSATLEPSQPTQAISAPAQPTYSSLSLQTSHLTPASAPAQTNQ 473

  Fly   306 IELQKKILSIMNKPAVTDVTS 326
            .|||.|||||.|..:.:.|.|
Zfish   474 QELQAKILSIFNSGSGSSVAS 494

Known Domains:


GeneSequenceDomainRegion External IDIdentity
NeosNP_001261502.1 RRM <19..>117 CDD:223796 29/119 (24%)
RRM_SF 20..78 CDD:302621 21/60 (35%)
HGTP_anticodon 130..221 CDD:294191 38/91 (42%)
ncoa5XP_005166217.1 RRM <1..168 CDD:223796 32/149 (21%)
RRM_hnRNPC_like 27..94 CDD:240787 23/67 (34%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C278148646
eggNOG 1 0.900 E1_KOG0845
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 147 1.000 Inparanoid score I4303
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 D421126at33208
OrthoFinder 1 1.000 FOG0002730
OrthoInspector 1 1.000 T128764
orthoMCL 1 0.900 OOG5_133491
Panther 1 1.100 LDO PTHR23295
Phylome 00.000 Not matched by this tool.
RoundUp 1 1.030 avgDist Average_Evolutionary_Distance R5288
TreeFam 1 0.960
ZFIN 00.000 Not matched by this tool.
109.880

Return to query results.
Submit another query.