DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Neos and CG14628

DIOPT Version :8

Sequence 1:NP_001261502.1 Gene:Neos / 38795 FlyBaseID:FBgn0024542 Length:371 Species:Drosophila melanogaster
Sequence 2:NP_569883.1 Gene:CG14628 / 31057 FlyBaseID:FBgn0040365 Length:141 Species:Drosophila melanogaster

Alignment Length:97 Identity:44/98 (45%)
Similarity:59/98 (60%) Gaps:0/98 (0%)


  Fly     1 MSDPGSAGYNITKDPALAKSRIFLGNLPVCTREELVSICQPYGKVLGSMVQKNYGFVQFETEELA 65
            ||....||..:|..|...||||.:.|||||||:||..:|.|:|::|||:|..|.||:||..|..|
  Fly     1 MSASDIAGIELTSGPTGLKSRILVRNLPVCTRQELAYLCLPFGEILGSLVTNNQGFIQFARESEA 65

  Fly    66 NKAASALHKSTFKQNMLTVRNASIKSKAANAI 97
            ..|...|..:|||..::.|.|||.:|..|:.:
  Fly    66 KLAIETLDHTTFKSKVILVSNASFRSLNASCL 97

Known Domains:


GeneSequenceDomainRegion External IDIdentity
NeosNP_001261502.1 RRM <19..>117 CDD:223796 38/80 (48%)
RRM_SF 20..78 CDD:302621 30/58 (52%)
HGTP_anticodon 130..221 CDD:294191
CG14628NP_569883.1 RRM <19..>85 CDD:223796 33/66 (50%)
RRM_SF 22..85 CDD:240668 30/63 (48%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OrthoDB 1 1.010 D421126at33208
OrthoFinder 1 1.000 FOG0002730
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.