DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: BHD and bhd1

Sequence 1:NP_648090.1 Gene:BHD FlyBaseID:FBgn0261111 Length:460 Species:Drosophila melanogaster
Sequence 2:NP_595962.1 Gene:bhd1 PomBaseID:SPBC24C6.08c Length:367 Species:Schizosaccharomyces pombe

Alignment Length:364 Identity:70/365 (19%)
Similarity:115/365 (32%) Gaps:150/365 (41%)


  Fly     1 MNAVIALCHFCEAHGPCAIFCTQTL----------RDTKLEDLSLEQQTQKTCSACNYSMGKNNN 55
            |:.|.||.|||||.||..|||||.|          ..|....:.:.:....:..|....:...||
pombe     1 MDVVFALGHFCEAEGPSIIFCTQKLHRSTVSKFFEHPTSKRSIGVTENGNDSPEAFKNELDNRNN 65

  Fly    56 A-----------IYSRDTESGATFVSTKVAVLPE--------------------VASLVKQAAVL 89
            |           ::..|:|.   ::..||:..||                    .:|.|..:.||
pombe    66 ADSQSLQSSTESLFKADSED---YLCKKVSKGPESPRVNSFHNSYSRNQSPISRKSSCVTCSTVL 127

  Fly    90 -----------------------------------------------------SLSNGTDASKDG 101
                                                                 :||..:|:..:.
pombe   128 PLEFSVPDVQPRLYTNSSTNPDVLYMSSQHPHTQQRYSTLKRLMVRCLSCEYSTLSEASDSMSNP 192

  Fly   102 EFVFFGDSSRGHILSHTFRVSDLQARGYSQLFSIIVLMKDKYFLLNIKPFLAEHLKKVSSELQAA 166
              :||||...|:::|.:|.:.|..|||..:.::||....::..|:....|::|....:...|:.:
pombe   193 --LFFGDQDNGYVISQSFSLRDPSARGGLRRYAIIATCPNQLDLILRYSFISEKFLHIVQFLRIS 255

  Fly   167 AKKTKETEEQTYSERQRRLSGAQFLMPT------------------------------------- 194
            :..||.....:.|:.....|...|..|:                                     
pombe   256 SFNTKNDYSSSRSKTTASSSNGTFASPSFNISSLSGSSNIGTAPSYEISSSIGANVSSLAHTQRL 320

  Fly   195 --------------SRALLELTGEEHIFAQLHSHFSWLL 219
                          .|:|:::|..:.||..|||.|||:|
pombe   321 PSFSFLRRRDDIGEGRSLVDITCWDGIFVGLHSSFSWIL 359

Known Domains:


GeneSequenceDomainRegion External IDIdentity
BHDNP_648090.1 Folliculin 67..221 CDD:288541 46/278 (17%)
Folliculin_C 275..459 CDD:293297
bhd1NP_595962.1 Folliculin 152..359 CDD:288541 37/209 (18%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 FOG0003911
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 OOG5_131714
Panther 1 1.100 LDO PTHR31441
Phylome 1 0.910 0.800 Consistency score
RoundUp 1 1.030 avgDist Average_Evolutionary_Distance R140
TreeFam 00.000 Not matched by this tool.
54.940

Return to query results.
Submit another query.