DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: BHD and Flcn

Sequence 1:NP_648090.1 Gene:BHD FlyBaseID:FBgn0261111 Length:460 Species:Drosophila melanogaster
Sequence 2:NP_001258285.1 Gene:Flcn MGIID:2442184 Length:579 Species:Mus musculus

Alignment Length:565 Identity:154/566 (27%)
Similarity:242/566 (43%) Gaps:114/566 (20%)


  Fly     1 MNAVIALCHFCEAHGPCAIFCTQTLR----------------------------------DTKLE 31
            |||::|||||||.|||..:|||:.|.                                  .:..|
Mouse     1 MNAIVALCHFCELHGPRTLFCTEVLHAPLPQGAGSGDSPDQVEQAEEEEGGIQMSSRVRAHSPAE 65

  Fly    32 DLSLEQQT-----QKTCSACNYSMGKNNNAIYSRDTESGATFVSTKVAVLPEVASLVKQAAVLSL 91
            ..|.|..:     ...|..|. |:...:....|.|.|:...:||.:....|::.|:|:||.|.||
Mouse    66 GASSESSSPGPKKSDMCEGCR-SLAVGHPGYISHDKETSIKYVSHQHPNHPQLFSIVRQACVRSL 129

  Fly    92 SNGTDASKDGEFVFFGDSSRGHILSHTFRVSDLQARGYSQLFSIIVLMKDKYFLLNIKPFLAEHL 156
            |......::|. :||||...|.:.||||.:.|..|||:.:.:|||.:|.|:.:|:|..|||...:
Mouse   130 SCEVCPGREGP-IFFGDEQHGFVFSHTFFIKDSLARGFQRWYSIIAIMMDRIYLINSWPFLLGRI 193

  Fly   157 KKVSSELQAAAKKTKETEEQTYSERQRRLSGA--QFLMP----TSRALLELTGEEHIFAQLHSHF 215
            :.:.|||||.|.|..|.|:....:|.:|::.|  .||..    .:|:|..||.:::::|.||:.|
Mouse   194 RGIISELQAKAFKVFEAEQFGCPQRAQRMNTAFTPFLHQRNGNAARSLTSLTSDDNLWACLHTSF 258

  Fly   216 SWLLLA-GSRFLTEHVTFG--------------------------------NLPWLPPQSSGRPP 247
            :|||.| ||| |||.:..|                                ..|..|..:.||..
Mouse   259 AWLLKACGSR-LTEKLLEGAPTEDTLVQMEKLADLEEESESWDNSEAEEEEKAPVTPEGAEGREL 322

  Fly   248 AQRLTYNSSTLPMIESIDDPDLEEFFSLRHLKSVVRKEEFATVCYCALTGVKIVVRG-DPRKTFR 311
            ....| .||.|....|...|.|..|.||||::.|:....|..:.:..|.|.:::.:. |......
Mouse   323 TSCPT-ESSFLSACGSWQPPKLTGFKSLRHMRQVLGAPSFRMLAWHVLMGNQVIWKSRDVNLVHS 386

  Fly   312 FMVCLKKLLPEPMHNLMRIDAQHQHSISSEYKIISVSNDIAVP---MASSSVYRIDFL------- 366
            ....|:.:||.....::...:|::.:....:  :.:|..:.:|   :||..|..::..       
Mouse   387 AFEVLRTMLPVGCVRIIPYSSQYEEAYRCNF--LGLSPPVPIPAHVLASEFVVVVEVHTATRSNL 449

  Fly   367 -------DKHVNGHE--VSVKWPGELPRKLPDLMVKLLKAVEEKNFTELVLNKQTKVLIEEWKNK 422
                   |:.::.:|  |:...|....|..|.::.|:..|:..:|.:..|:::....|.|||.||
Mouse   450 HPAGCEDDQSLSKYEFVVTSGSPVAADRVGPTILNKIEAALTNQNLSVDVVDQCLICLKEEWMNK 514

  Fly   423 VTCLNHAKSTSVQG-------KLKKVLGVQPHDQ-PIINYWSTHL 459
            |..|  .|.|.|..       ||..|||....|. .::.:|.|.|
Mouse   515 VKVL--FKFTKVDSRPKEDTQKLLSVLGASEEDNVKLLKFWMTGL 557

Known Domains:


GeneSequenceDomainRegion External IDIdentity
BHDNP_648090.1 Folliculin 67..221 CDD:288541 60/160 (38%)
Folliculin_C 275..459 CDD:293297 46/212 (22%)
FlcnNP_001258285.1 Folliculin 106..264 CDD:288541 60/159 (38%)
Folliculin_C 349..563 CDD:293297 47/214 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C304064771
eggNOG 1 0.900 E1_KOG3715
Hieranoid 1 1.000
Homologene 1 1.000 H14583
Inparanoid 1 1.050 158 1.000 Inparanoid score I4227
Isobase 00.000 Not matched by this tool.
OMA 1 1.010
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 FOG0003911
OrthoInspector 1 1.000 T1084851
orthoMCL 1 0.900 OOG5_131714
Panther 1 1.100 LDO PTHR31441
Phylome 1 0.910 0.667 Consistency score
RoundUp 1 1.030 avgDist Average_Evolutionary_Distance R140
TreeFam 1 0.960
1312.790

Return to query results.
Submit another query.