DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: BHD and FLCN

Sequence 1:NP_648090.1 Gene:BHD FlyBaseID:FBgn0261111 Length:460 Species:Drosophila melanogaster
Sequence 2:NP_001340158.1 Gene:FLCN HGNCID:27310 Length:597 Species:Homo sapiens

Alignment Length:592 Identity:157/593 (26%)
Similarity:249/593 (42%) Gaps:150/593 (25%)


  Fly     1 MNAVIALCHFCEAHGPCAIFCTQTLR----------------------------------DTKLE 31
            |||::|||||||.|||..:|||:.|.                                  .:..|
Human     1 MNAIVALCHFCELHGPRTLFCTEVLHAPLPQGDGNEDSPGQGEQAEEEEGGIQMNSRMRAHSPAE 65

  Fly    32 DLSLEQQT-----QKTCSACNYSMGKNNNAIYSRDTESGATFVSTKVAVLPEVASLVKQAAVLSL 91
            ..|:|..:     ...|..|. |:...:....|.|.|:...:||.:....|::.|:|:||.|.||
Human    66 GASVESSSPGPKKSDMCEGCR-SLAAGHPGYISHDKETSIKYVSHQHPSHPQLFSIVRQACVRSL 129

  Fly    92 SNGTDAS------------------KDGEFVFFGDSSRGHILSHTFRVSDLQARGYSQLFSIIVL 138
            |.....|                  ::|. :||||...|.:.||||.:.|..|||:.:.:|||.:
Human   130 SCECRESAVAALTCWFFCMLQVCPGREGP-IFFGDEQHGFVFSHTFFIKDSLARGFQRWYSIITI 193

  Fly   139 MKDKYFLLNIKPFLAEHLKKVSSELQAAAKKTKETEEQTYSERQRRLSGA--QFLMP----TSRA 197
            |.|:.:|:|..|||...::.:..|||..|.|..|.|:....:|.:|::.|  .||..    .:|:
Human   194 MMDRIYLINSWPFLLGKVRGIIDELQGKALKVFEAEQFGCPQRAQRMNTAFTPFLHQRNGNAARS 258

  Fly   198 LLELTGEEHIFAQLHSHFSWLLLA-GSRFLTEHVTFG---------------------------- 233
            |..||.:::::|.||:.|:|||.| ||| |||.:..|                            
Human   259 LTSLTSDDNLWACLHTSFAWLLKACGSR-LTEKLLEGAPTEDTLVQMEKLADLEEESESWDNSEA 322

  Fly   234 ----NLPWLPPQSSGRP----PAQRLTYNSSTLPMIESIDDPDLEEFFSLRHLKSVVRKEEFATV 290
                ..|.||..:.||.    ||:     ||:|....|.....|..|.||||::.|:....|..:
Human   323 EEEEKAPVLPESTEGRELTQGPAE-----SSSLSGCGSWQPRKLPVFKSLRHMRQVLGAPSFRML 382

  Fly   291 CYCALTGVKIVVRG-DPRKTFRFMVCLKKLLPEPMHNLMRIDAQHQ------------------H 336
            .:..|.|.:::.:. |..........|:.:||.....::...:|::                  |
Human   383 AWHVLMGNQVIWKSRDVDLVQSAFEVLRTMLPVGCVRIIPYSSQYEEAYRCNFLGLSPHVQIPPH 447

  Fly   337 SISSEYKIISVSNDIAVPMAS-SSVYRI---DFLDKHVNGHE--VSVKWPGELPRKLPDLMVKLL 395
            .:|||:.:|     :.|..|: |:::.:   |  |:.::.:|  |:...|....|..|.::.|:.
Human   448 VLSSEFAVI-----VEVHAAARSTLHPVGCED--DQSLSKYEFVVTSGSPVAADRVGPTILNKIE 505

  Fly   396 KAVEEKNFTELVLNKQTKVLIEEWKNKVTCLNHAKSTSVQG-------KLKKVLGVQPHDQ-PII 452
            .|:..:|.:..|:::....|.|||.|||..|  .|.|.|..       ||..:||....|. .::
Human   506 AALTNQNLSVDVVDQCLVCLKEEWMNKVKVL--FKFTKVDSRPKEDTQKLLSILGASEEDNVKLL 568

  Fly   453 NYWSTHL 459
            .:|.|.|
Human   569 KFWMTGL 575

Known Domains:


GeneSequenceDomainRegion External IDIdentity
BHDNP_648090.1 Folliculin 67..221 CDD:288541 59/178 (33%)
Folliculin_C 275..459 CDD:293297 49/217 (23%)
FLCNNP_001340158.1 Folliculin 106..283 CDD:314549 60/178 (34%)
Folliculin_C 367..581 CDD:318824 50/219 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C304065206
eggNOG 1 0.900 E1_KOG3715
Hieranoid 1 1.000
Homologene 1 1.000 H14583
Inparanoid 1 1.050 155 1.000 Inparanoid score I4252
Isobase 00.000 Not matched by this tool.
OMA 1 1.010
OrthoDB 1 1.010 D593097at33208
OrthoFinder 1 1.000 FOG0003911
OrthoInspector 1 1.000 T1074752
orthoMCL 1 0.900 OOG5_131714
Panther 1 1.100 LDO PTHR31441
Phylome 1 0.910 0.667 Consistency score
RoundUp 00.000 Not matched by this tool.
TreeFam 1 0.960
User_Submission 00.000 Not matched by this tool.
1312.770

Return to query results.
Submit another query.