DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: BHD and flcn-1

Sequence 1:NP_648090.1 Gene:BHD FlyBaseID:FBgn0261111 Length:460 Species:Drosophila melanogaster
Sequence 2:NP_001022106.3 Gene:flcn-1 WormBaseID:WBGene00017699 Length:707 Species:Caenorhabditis elegans

Alignment Length:705 Identity:143/706 (20%)
Similarity:234/706 (33%) Gaps:265/706 (38%)


  Fly     1 MNAVIALCHFCEAHGPCAIFCTQTLRD-------------------------------------- 27
            |.||||||||||.|||..:...|.:||                                      
 Worm     1 MQAVIALCHFCENHGPRVVMTCQPMRDVDDKGASCTASTSLGPSTSSSPPGIIVPLIKFDGECVV 65

  Fly    28 ---TKLED----------LSLEQQTQKTCSACNYSMGKNNNAIYSRDTESGATFVSTKVAVLPEV 79
               |..||          ......|:..||||  |..:|...:.|.|.::..:::|::||:...|
 Worm    66 KEKTNTEDGTSYPHYGNCTKFTIDTEDRCSAC--SSFRNGPCLLSNDHQTKTSYISSEVALQDRV 128

  Fly    80 ASLVKQAAVLSLS-----------------------------------------NGT-------- 95
            ...||.|.:.|||                                         :||        
 Worm   129 YERVKNACLRSLSCEVSAASKKNPVQPPPPPLSRSTTPRKIHPYVIHEEPLHDFSGTRIPPSSTV 193

  Fly    96 --DASKDGEF-----------VFFGDSSRGHILSHTFRVSDLQARGYSQLFSIIVLMKDKYFLLN 147
              :..:||.|           |.|||:..|...::.||::|.:|||:.:|||:||:..|..||.|
 Worm   194 LQEPIEDGAFEQPAAEEADGYVIFGDTDNGFCFAYIFRLADAKARGFYRLFSLIVVSNDLTFLTN 258

  Fly   148 IKPFLAEHLKKVSSELQAAAKKT---------KETEEQTYSERQRRLSG-------AQFLMPTSR 196
            ...:....|..:.::||..|:..         |.:|:..:....::|.|       .:..:.|.|
 Worm   259 NFEYFKTTLGGIKNDLQKLAQDVFSREIDTGEKLSEDDIHKPEFQKLVGKMPSWYRRKIAIDTDR 323

  Fly   197 ALLELTGEEHIFAQLHSHFSWLLLAGSRFLTEHVTFGNLPWLPPQ-------------------S 242
            .|..:|....|:.|||.|..|.|.:.:....:.|..|.    |.|                   .
 Worm   324 NLTVVTANNDIWVQLHRHMMWTLRSPTLACLDQVMEGK----PTQDMMVSALGTGGIPNCGTRTE 384

  Fly   243 SGRPPAQRL--------------------TYNSST-----------LPMIESID----------- 265
            :.:|..:.|                    :.:||.           :|:|..|.           
 Worm   385 ASKPTPENLHAVDRFNIPVQYQLKSMCIASVSSSVAIQNEKILREEMPLIIEIQNIPPSFMMRVH 449

  Fly   266 ---------DPDLEEFFSLRHLKSVVRKEEFATVCYCA-------------------LTGVKIVV 302
                     :||..|......:|..|...:.|.:...|                   :||.::||
 Worm   450 EKNESALATEPDDFEGCENETIKGKVSMAQLANLKIIATQLNTCSEPGDLDLLIRHIVTGGQVVV 514

  Fly   303 RGDPRKTFR-FMVCLKKLLPEPMHNLMRIDAQHQHSISSEYKIISVSNDIAVPMASSSVYRIDFL 366
            ....::..| |::.:..|||.....|.....|:....||.:.:|...:::.:|:..|     |.:
 Worm   515 ESREKEYCRQFLLAISNLLPIGCIKLATYKEQYLPEYSSRFNLIGGPHNMDIPLEVS-----DVM 574

  Fly   367 DKHVNGHEVSV----------------KWP------GELPR---KLPDLMVKLLKAVEEKNFTEL 406
            ...|:..:||:                :.|      |.|||   :..||::       :.:.|:.
 Worm   575 VFRVSPRDVSIVDIEQMSLVNCVIEVRRRPENDGSNGPLPRIVNRYRDLLL-------DSDVTDT 632

  Fly   407 VLNKQTKVLIEEW--KNKVTCLNHAKSTSVQGKLKKVLGVQPHDQPIINYWSTHL 459
            :|....:...|.|  |.|: |....|..|.....:.:.|....||.:::||:..|
 Worm   633 ILETALRTTREGWMLKAKI-CYQMTKQLSHPQVFEHITGCGVEDQQVVSYWTAGL 686

Known Domains:


GeneSequenceDomainRegion External IDIdentity
BHDNP_648090.1 Folliculin 67..221 CDD:288541 54/232 (23%)
Folliculin_C 275..459 CDD:293297 45/231 (19%)
flcn-1NP_001022106.3 Folliculin 116..348 CDD:288541 54/232 (23%)
Folliculin_C 498..691 CDD:293297 42/203 (21%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C304050573
eggNOG 1 0.900 E1_KOG3715
Hieranoid 1 1.000
Homologene 1 1.000 H14583
Inparanoid 1 1.050 149 1.000 Inparanoid score I2945
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 D593097at33208
OrthoFinder 1 1.000 FOG0003911
OrthoInspector 1 1.000 T475287
orthoMCL 1 0.900 OOG5_131714
Panther 1 1.100 LDO PTHR31441
Phylome 00.000 Not matched by this tool.
RoundUp 1 1.030 avgDist Average_Evolutionary_Distance R140
TreeFam 00.000 Not matched by this tool.
1110.920

Return to query results.
Submit another query.