DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG14829 and CG34428

Sequence 1:NP_648089.2 Gene:CG14829 FlyBaseID:FBgn0035751 Length:219 Species:Drosophila melanogaster
Sequence 2:NP_001097597.2 Gene:CG34428 FlyBaseID:FBgn0085457 Length:247 Species:Drosophila melanogaster

Alignment Length:249 Identity:65/250 (26%)
Similarity:104/250 (42%) Gaps:64/250 (26%)


  Fly     9 LLACSLPVVRSAYMLVAAPVGQNITEYMHARQKRHQ---LIYRNGGTIRLVVGPVLSTQLEDPVV 70
            |::|.|      |.::|: :|   :.:.|.|.||..   |||......|::....:...||| :.
  Fly     9 LVSCLL------YQVMAS-LG---SLFKHQRSKRAPIPWLIYPTTSPTRVMFIGGIGIPLED-LN 62

  Fly    71 WRSLVYYYVLHFGAFTLPSAPLYPWDKWETIYARSL-------------QEK------IRSLDET 116
            :.::...|||.. .:.||:.|    |...|..|..|             |.|      :..:||.
  Fly    63 YEAVTTGYVLKV-EYWLPTTP----DDLRTPTALPLTQVATPGVTGARKQRKPMFENFLVGVDEL 122

  Fly   117 HEDDTRLF-------------VYAALENYMDQVSGSPGRGRHCLLRGICENAQ--VHHHVGIMAE 166
            .::..:|.             ||..||...|::.   .:||.|:|:.|||.|:  .|:..|:.|:
  Fly   123 GKNTRKLLTRTNKVLSSYRWTVYKGLEGLADRLG---YQGRICVLKSICEAAEEPFHYTNGLFAD 184

  Fly   167 LLVVLLTPGKT------RLDVAYKEALAAGQAGIDCLARYSDCPRGESVLDAYA 214
            ||.:||||..:      ..|..|..|...||:|..|...:.:|.|  |:|..::
  Fly   185 LLHILLTPSSSVDKLSEHADNEYYYAEKMGQSGAGCDRVFKECRR--SLLQHFS 236

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG14829NP_648089.2 DM4_12 117..210 CDD:214785 33/114 (29%)
CG34428NP_001097597.2 None


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C48185
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 P PTHR21398
RoundUp 00.000 Not matched by this tool.
22.030

Return to query results.
Submit another query.