DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG14829 and CG34429

Sequence 1:NP_648089.2 Gene:CG14829 FlyBaseID:FBgn0035751 Length:219 Species:Drosophila melanogaster
Sequence 2:NP_001097598.1 Gene:CG34429 FlyBaseID:FBgn0085458 Length:249 Species:Drosophila melanogaster

Alignment Length:204 Identity:50/205 (24%)
Similarity:83/205 (40%) Gaps:32/205 (16%)


  Fly    45 LIY--RNGGTIRLVVG---PVLSTQLEDPVVWRSLVYYYVLHFGAFTLPSAPLYPWDKWETIYAR 104
            |||  .|...::::.|   |....::|..:....|...|.|.:.|..|.:..::...:...:...
  Fly    44 LIYPRANPTRLQMIAGFGIPAEDLKVESVITGYVLKAQYYLPYSAKQLRTKDVHEISESRLLQNA 108

  Fly   105 SLQEKIRSLDE---------THED-----DTRLFVYAALENYMDQVSGSPGRGRHCLLRGICENA 155
            ::.:|:..:.|         ..||     ..|..||.|......::..:   ||.|:|:.|||:|
  Fly   109 TIFDKVMQMSEQKLGFDPDILQEDLQALGSYRWSVYEAFTALAIRMKLN---GRVCVLKSICESA 170

  Fly   156 QV--HHHVGIMAELLVVLLTPGKT------RLDVAYKEALAAGQAGIDCLARYSDCPRG--ESVL 210
            ..  ....|::.|:|.:||||..:      ..|..|.:|...|.||.||...|..||:.  |...
  Fly   171 AAPFDDRNGLLGEVLHILLTPSSSVDPLSEHSDNDYLQAERLGAAGGDCDQVYPRCPKSLLEHFS 235

  Fly   211 DAYALDVEY 219
            |.:.|..|:
  Fly   236 DVHHLGSEF 244

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG14829NP_648089.2 DM4_12 117..210 CDD:214785 33/108 (31%)
CG34429NP_001097598.1 DM4_12 137..233 CDD:214785 31/99 (31%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C48122
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 P PTHR21398
RoundUp 00.000 Not matched by this tool.
22.030

Return to query results.
Submit another query.