DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG14829 and CG34442

Sequence 1:NP_648089.2 Gene:CG14829 FlyBaseID:FBgn0035751 Length:219 Species:Drosophila melanogaster
Sequence 2:NP_001097311.1 Gene:CG34442 FlyBaseID:FBgn0085471 Length:245 Species:Drosophila melanogaster

Alignment Length:103 Identity:26/104 (25%)
Similarity:48/104 (46%) Gaps:10/104 (10%)


  Fly   121 TRLFVYAALENYMDQVSGSPGRGRHCLLRGICEN--AQVHHHVGIMAELLVVLLTPGKTR---LD 180
            :|...||.|.:.:.: ||.|  ...||||.||:.  :|:....|.:..|:.::.:|..::   |.
  Fly   135 SRSVFYAMLRDKLRR-SGFP--AEPCLLRLICDTNASQLGEVNGFLGSLVHIIFSPSSSKDEHLP 196

  Fly   181 VAYKEALAAGQAGIDCLARYSDCPRGESVLDAYALDVE 218
            ..|.:|...|:...:|......|  ..::||..::.:|
  Fly   197 NEYYQAEWDGREQQECSTYTKSC--DHNILDLVSVSLE 232

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG14829NP_648089.2 DM4_12 117..210 CDD:214785 23/94 (24%)
CG34442NP_001097311.1 DM4_12 136..219 CDD:285126 22/86 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C48809
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 P PTHR21398
RoundUp 00.000 Not matched by this tool.
22.030

Return to query results.
Submit another query.