DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG14829 and CG34443

Sequence 1:NP_648089.2 Gene:CG14829 FlyBaseID:FBgn0035751 Length:219 Species:Drosophila melanogaster
Sequence 2:NP_001097312.1 Gene:CG34443 FlyBaseID:FBgn0085472 Length:239 Species:Drosophila melanogaster

Alignment Length:172 Identity:45/173 (26%)
Similarity:66/173 (38%) Gaps:55/173 (32%)


  Fly    85 FTLPSAPLYPWDKWETIYARSLQEKIRSLDETH-EDDTRLFVYAALEN----------------- 131
            :.||:    .|:|| ||:.....|....:|||. |.|.:|  .|..:|                 
  Fly    60 YNLPA----NWEKW-TIFQNGPIESEEVVDETDTETDRKL--AAGCQNCTVKEENEAGSEEVEEI 117

  Fly   132 ----------------------YMDQVSGSPGRGRHCLLRGICEN--AQVHHHVGIMAELLVVLL 172
                                  ::|::..|..||..||||.|||.  ||:....|::..|:.||.
  Fly   118 TEVLPQERKVRSLLTRSNIYRIFVDKLKRSGFRGESCLLRLICETSAAQLDEFNGVLGSLMHVLF 182

  Fly   173 TPGKTR---LDVAYKEALAAGQAGIDCLARYSDCPRGESVLD 211
            :|..:.   |.:.|.:|...|..| .|......|  |||:|:
  Fly   183 SPSSSESEDLPLRYYQAEHDGWNG-HCHVYEPGC--GESILE 221

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG14829NP_648089.2 DM4_12 117..210 CDD:214785 33/138 (24%)
CG34443NP_001097312.1 DM4_12 133..215 CDD:285126 24/83 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C48662
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 P PTHR21398
RoundUp 00.000 Not matched by this tool.
22.030

Return to query results.
Submit another query.