powered by:
Protein Alignment CG14829 and CG42812
DIOPT Version :9
| Sequence 1: | NP_648089.2 |
Gene: | CG14829 / 38792 |
FlyBaseID: | FBgn0035751 |
Length: | 219 |
Species: | Drosophila melanogaster |
| Sequence 2: | NP_001097901.2 |
Gene: | CG42812 / 50072 |
FlyBaseID: | FBgn0261994 |
Length: | 217 |
Species: | Drosophila melanogaster |
| Alignment Length: | 160 |
Identity: | 42/160 - (26%) |
| Similarity: | 67/160 - (41%) |
Gaps: | 41/160 - (25%) |
- Green bases have known domain annotations that are detailed below.
|
Fly 73 SLVYYYVLHFGAFTLPSAPLYPWDKWETIYARSLQEKIRSLDET------HEDDTRLF------- 124
::.|.|..:...|. |.|: |..:....|:....::...||. |::...:.
Fly 56 AISYNYPYNLTEFY--SIPI--WPGFANYKAKREVPQLEMTDENFYTKYGHDNGNGMHPKDFSAG 116
Fly 125 -VYAALENYMDQVSGSPGRGRH--CLLRGICENAQ-----VHHHVGIMAELLVVLLTPG-----K 176
:||.||:.: .|.|.| ||||.:||.|| .|.| ::::::..:|:|. :
Fly 117 ELYAFLEDTL------TGYGFHETCLLRSVCELAQHPFDDSHQH--LLSDIVTFVLSPSQHEGFR 173
Fly 177 TRLDV---AYKEALAAGQAGIDCLARYSDC 203
...|| ||:.|...|..|.|||..||.|
Fly 174 DDEDVYRKAYELAEQDGFLGRDCLRLYSHC 203
|
Known Domains:
Indicated by green bases in alignment.
| Gene | Sequence | Domain | Region |
External ID | Identity |
| CG14829 | NP_648089.2 |
DM4_12 |
117..210 |
CDD:214785 |
33/110 (30%) |
| CG42812 | NP_001097901.2 |
DM4_12 |
110..210 |
CDD:214785 |
32/102 (31%) |
Information from Original Tools:
| Tool |
Simple Score |
Weighted Score |
Original Tool Information |
| BLAST Result |
Score |
Score Type |
Cluster ID |
| Compara |
1 |
0.930 |
- |
- |
|
C45452629 |
| Domainoid |
0 | 0.000 |
Not matched by this tool. |
| eggNOG |
0 | 0.000 |
Not matched by this tool. |
| Homologene |
0 | 0.000 |
Not matched by this tool. |
| Inparanoid |
0 | 0.000 |
Not matched by this tool. |
| Isobase |
0 | 0.000 |
Not matched by this tool. |
| OMA |
0 | 0.000 |
Not matched by this tool. |
| OrthoDB |
0 | 0.000 |
Not matched by this tool. |
| OrthoFinder |
0 | 0.000 |
Not matched by this tool. |
| OrthoInspector |
0 | 0.000 |
Not matched by this tool. |
| orthoMCL |
0 | 0.000 |
Not matched by this tool. |
| Panther |
1 |
1.100 |
- |
- |
P |
PTHR21398 |
| Phylome |
1 |
0.910 |
- |
- |
|
|
| RoundUp |
0 | 0.000 |
Not matched by this tool. |
| SonicParanoid |
0 | 0.000 |
Not matched by this tool. |
|
3 | 2.940 |
|
Return to query results.
Submit another query.