DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG14829 and CG13616

Sequence 1:NP_648089.2 Gene:CG14829 FlyBaseID:FBgn0035751 Length:219 Species:Drosophila melanogaster
Sequence 2:NP_651262.1 Gene:CG13616 FlyBaseID:FBgn0039200 Length:231 Species:Drosophila melanogaster

Alignment Length:219 Identity:46/220 (21%)
Similarity:92/220 (42%) Gaps:48/220 (22%)


  Fly     9 LLACSLPV--VRSAYMLVAAPVGQ--NITEYMHARQKRHQLIYRNG----GTIRLVVGPVLSTQL 65
            |||..|.:  |:|..|.:::...:  .:|:.:. |.||: |.:..|    |.:.:.:|.:.:..:
  Fly    11 LLALCLLLHEVQSQVMSMSSAANRTGEVTKVLR-RHKRY-LAFPEGSSVSGAVCMTIGMIGNPDV 73

  Fly    66 EDPVVWRSLVYYYVLHFG-AFTLPSAPLYPWDKWETIYARSLQEKIRSLDETHEDDTRLFVYAAL 129
             |.:.|       .:::| |:.||:      .:|...:|..|...:..  :|.:..:|...|..:
  Fly    74 -DYLSW-------AVNWGVAYDLPN------HQWVIQHAHGLNATLAK--DTIKRRSRRAFYDEV 122

  Fly   130 ENYMDQVSGSPGRGRHCLLRGICENAQVH----HHVGIMAELL--VVLLTPGKT---------RL 179
            ::..|.:..:   ||.|:.|.:||:|:..    ....::.||:  |..|.|...         :.
  Fly   123 QSLFDNMGFN---GRSCVARALCESAKFMLPSVERGNMLQELVRTVFSLPPSPVAAHEPQAHHQY 184

  Fly   180 DVAYKEALAAGQAGIDCLARYSDC 203
            |..|:.:..:.:   ||...|..|
  Fly   185 DRIYRRSKRSSR---DCHEIYPGC 205

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG14829NP_648089.2 DM4_12 117..210 CDD:214785 21/103 (20%)
CG13616NP_651262.1 DM4_12 110..212 CDD:214785 21/103 (20%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C49093
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 P PTHR21398
RoundUp 00.000 Not matched by this tool.
22.030

Return to query results.
Submit another query.