DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG14829 and CG5768

Sequence 1:NP_648089.2 Gene:CG14829 FlyBaseID:FBgn0035751 Length:219 Species:Drosophila melanogaster
Sequence 2:NP_651260.3 Gene:CG5768 FlyBaseID:FBgn0039198 Length:262 Species:Drosophila melanogaster

Alignment Length:189 Identity:46/190 (24%)
Similarity:78/190 (41%) Gaps:56/190 (29%)


  Fly    25 AAPVGQNITEYMHARQKRHQLIYRNG----GTIRLVVGPVLSTQLEDPVVWRSLVYYYV-LHFG- 83
            |||..|.    ..:|.||. :.:..|    |.:.|..|.:     .:|    :|:|..: :::| 
  Fly    72 AAPSSQR----KLSRGKRF-VAFPQGSSASGAVCLTTGVI-----GNP----NLLYLSLGINWGV 122

  Fly    84 AFTLPSAPLYPW-----DKWETIYARSLQEKIRSLDETHEDDTRLFVYAALENYMDQVSGSPGRG 143
            |:.||:.   .|     ..|.|  .:|.|.:|:   ..|    |..:|..||..:|.:..:   |
  Fly   123 AYDLPNV---TWVLQNAHGWTT--KKSAQAQIK---RRH----RRELYGRLETMIDSMGYN---G 172

  Fly   144 RHCLLRGICENAQVHHH--VGIMAELLVVLLTPGKTRL--------------DVAYKEA 186
            |.|:||.:||:.|....  :.::.|:|..:.:..|.|:              |.||:.|
  Fly   173 RDCILRTLCESRQYFQRTKMSMVGEMLRTIFSLPKQRIFTRELHENADIVHYDQAYRNA 231

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG14829NP_648089.2 DM4_12 117..210 CDD:214785 22/87 (25%)
CG5768NP_651260.3 DM4_12 149..248 CDD:214785 23/94 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C49106
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 P PTHR21398
RoundUp 00.000 Not matched by this tool.
22.030

Return to query results.
Submit another query.