DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG14829 and CG5768

DIOPT Version :9

Sequence 1:NP_648089.2 Gene:CG14829 / 38792 FlyBaseID:FBgn0035751 Length:219 Species:Drosophila melanogaster
Sequence 2:NP_001369031.1 Gene:CG5768 / 42915 FlyBaseID:FBgn0039198 Length:397 Species:Drosophila melanogaster


Alignment Length:123 Identity:29/123 - (23%)
Similarity:47/123 - (38%) Gaps:43/123 - (34%)


- Green bases have known domain annotations that are detailed below.


  Fly    80 LHFGAFTLPSAPLYPWDKWETIYARSLQEKIRSLDETHEDDTRLFVYAALENYMDQVSGSPGRGR 144
            || |..|.|.||..            |:.:.||.           :|..:|..:|.:..:   ||
  Fly   271 LH-GFATHPVAPAV------------LRRRSRSA-----------IYRQIEAVVDNMGYN---GR 308

  Fly   145 HCLLRGICENAQVHHH--VGIMAELLVVLLTPGKTRL--------------DVAYKEA 186
            .|:||.:||:.|....  :.::.|:|..:.:..|.|:              |.||:.|
  Fly   309 DCILRTLCESRQYFQRTKMSMVGEMLRTIFSLPKQRIFTRELHENADIVHYDQAYRNA 366

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG14829NP_648089.2 DM4_12 117..210 CDD:214785 19/86 (22%)
CG5768NP_001369031.1 DM4_12 286..383 CDD:214785 21/95 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45452667
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR21398
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.940

Return to query results.
Submit another query.