DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG14829 and CG17781

Sequence 1:NP_648089.2 Gene:CG14829 FlyBaseID:FBgn0035751 Length:219 Species:Drosophila melanogaster
Sequence 2:NP_651258.1 Gene:CG17781 FlyBaseID:FBgn0039196 Length:429 Species:Drosophila melanogaster

Alignment Length:147 Identity:37/148 (25%)
Similarity:55/148 (37%) Gaps:46/148 (31%)


  Fly    88 PSAPLYPWDKWETIYARSLQEKIRSLD-ETHED--------DTRLFVYAALEN-YMDQVSGSPGR 142
            |...:||      ::||  :.:.|||| :.|.:        .:|..::..:|. |..:..    .
  Fly   291 PKHHIYP------VFAR--RRRRRSLDQDAHFERLHLQQHLSSRQLLFGKIERLYKSRRL----N 343

  Fly   143 GRHCLLRGICENAQVHHHV-----------GIMAELLVVLLTPGKTRLDVAYKEAL--------- 187
            |..|:||.:||::|...||           .||..|..:...|...  ||...|.|         
  Fly   344 GTSCVLRALCESSQRQQHVLRGTNAVRPQSFIMEILSAIFQLPSSD--DVEELEELELMISPNYL 406

  Fly   188 -AAGQAGIDCLARYSDC 203
             |..|.| :|...|.||
  Fly   407 EAHRQKG-NCRQIYGDC 422

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG14829NP_648089.2 DM4_12 117..210 CDD:214785 28/118 (24%)
CG17781NP_651258.1 DM4_12 321..428 CDD:214785 27/110 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C48404
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 P PTHR21398
RoundUp 00.000 Not matched by this tool.
22.030

Return to query results.
Submit another query.