DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG14829 and CG17782

Sequence 1:NP_648089.2 Gene:CG14829 FlyBaseID:FBgn0035751 Length:219 Species:Drosophila melanogaster
Sequence 2:NP_651257.1 Gene:CG17782 FlyBaseID:FBgn0039195 Length:479 Species:Drosophila melanogaster

Alignment Length:132 Identity:35/133 (26%)
Similarity:58/133 (44%) Gaps:13/133 (10%)


  Fly    82 FGAFTLPSAPLYPWDKWETIYARSLQEKIRSLDE---THEDDTRLFVYAALENYMDQVSGSPGRG 143
            ||..::|.|......:..:..|...::|:..|::   .|...:|..:|..:|.|:|:   ....|
  Fly   340 FGKRSIPDAANPHKRQRRSGVATEHEDKMSRLEQLQIKHHRRSRQSLYERIEKYLDK---RGHHG 401

  Fly   144 RHCLLRGICENAQ--VHHHVG-IMAELL--VVLLTPGKTRLDVAYKEAL--AAGQAGIDCLARYS 201
            .||:||.:||..|  ..|..| .:.||:  |..|........|||:::.  .|..:..||...|.
  Fly   402 HHCVLRTLCETGQKSTEHEPGTFVGELMRAVFTLPEAMDNEPVAYRDSHYDKAHASKADCAVLYP 466

  Fly   202 DC 203
            :|
  Fly   467 EC 468

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG14829NP_648089.2 DM4_12 117..210 CDD:214785 28/95 (29%)
CG17782NP_651257.1 DM4_12 378..475 CDD:214785 28/95 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C48453
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 P PTHR21398
RoundUp 00.000 Not matched by this tool.
22.030

Return to query results.
Submit another query.