DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG14829 and CG13613

Sequence 1:NP_648089.2 Gene:CG14829 FlyBaseID:FBgn0035751 Length:219 Species:Drosophila melanogaster
Sequence 2:NP_001097900.2 Gene:CG13613 FlyBaseID:FBgn0039193 Length:219 Species:Drosophila melanogaster

Alignment Length:133 Identity:35/134 (26%)
Similarity:55/134 (41%) Gaps:34/134 (25%)


  Fly   100 TIYARSL-QEKIRSLDETHE---------------DDTRLFVYAALENYMDQVSGSPGRGRHCLL 148
            ||:|..| :.:.|.||.:.:               |.|...:|..:||.::    :.|..|.|||
  Fly    79 TIWADELSRRQKRQLDHSLDANLQQYDLEGGMHPADFTAGQLYKGIENMLE----TYGFHRSCLL 139

  Fly   149 RGICENAQVH-----HHVGIMAELLVVLLTPG--------KTRLDVAYKEALAAGQAGIDCLARY 200
            |.:||.| :|     |..|::.:::..||||.        :......|::|...|..|..|...|
  Fly   140 RSVCELA-LHPFAEDHFYGMVTQVITFLLTPSQHEGFADDEQHYRDKYEKAEQIGFLGGQCHLSY 203

  Fly   201 SDC 203
            ..|
  Fly   204 PSC 206

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG14829NP_648089.2 DM4_12 117..210 CDD:214785 28/116 (24%)
CG13613NP_001097900.2 DM4_12 119..206 CDD:285126 25/92 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C48968
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 P PTHR21398
RoundUp 00.000 Not matched by this tool.
22.030

Return to query results.
Submit another query.