DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG14829 and CG17784

Sequence 1:NP_648089.2 Gene:CG14829 FlyBaseID:FBgn0035751 Length:219 Species:Drosophila melanogaster
Sequence 2:NP_651254.1 Gene:CG17784 FlyBaseID:FBgn0039192 Length:237 Species:Drosophila melanogaster

Alignment Length:178 Identity:56/179 (31%)
Similarity:81/179 (45%) Gaps:27/179 (15%)


  Fly    38 ARQKRHQLIYRNGGTIRLVVG---PVLSTQLEDPVVWRSLVYYYVLHFGAFTLPSAPLYPWDKWE 99
            :|.|| ..||...|.::||..   ||..|..|....|     ::.|. |.:...:.|||.|..|.
  Fly    58 SRSKR-VAIYNGQGVVKLVPSLAYPVKQTDKEQSFWW-----FFNLQ-GQWIPTTIPLYWWSFWN 115

  Fly   100 TI--------YARSLQEKIRSLDETHEDDTRLFVYAALENYMDQVSGSPGRGRHCLLRGICENAQ 156
            |.        :.:.:|.|:.      .|:.|.:||.|:|..|:|:.|:  .|..||||.|||.:|
  Fly   116 TTAFVSTAREWRKDMQAKVL------HDEARTWVYNAIEVGMEQLDGA--YGGVCLLRSICEISQ 172

  Fly   157 -VHHHVGIMAELLVVLLTPGKTRLDVAYKEALAAGQAGIDCLARYSDC 203
             ...:..|.:|::..:|.|....:...|..|..||:.|.||...||||
  Fly   173 KPFQNSNIFSEIVNAVLVPTLDNVASKYLHARDAGRGGADCERTYSDC 220

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG14829NP_648089.2 DM4_12 117..210 CDD:214785 33/89 (37%)
CG17784NP_651254.1 DM4_12 135..227 CDD:214785 33/95 (35%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C130746567
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 P PTHR21398
RoundUp 00.000 Not matched by this tool.
22.030

Return to query results.
Submit another query.