DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG14829 and CG14115

Sequence 1:NP_648089.2 Gene:CG14829 FlyBaseID:FBgn0035751 Length:219 Species:Drosophila melanogaster
Sequence 2:NP_648629.1 Gene:CG14115 FlyBaseID:FBgn0036343 Length:219 Species:Drosophila melanogaster

Alignment Length:206 Identity:49/207 (24%)
Similarity:76/207 (37%) Gaps:48/207 (23%)


  Fly    45 LIYRNGGTIRLVVGPVLSTQLEDPVVWRSLVYYYVLHFGA-FTLPSAPLY-PW-DKWE------- 99
            |::...|:..|:....:..:|....|      |...:|.: :.|||...| .| |:|:       
  Fly    25 LVFPRQGSFGLLAAVAIPLELGPKNV------YMAFNFESNYALPSNDSYNQWIDRWDLDDHYLG 83

  Fly   100 ------TIYARSLQEKIRSLDETHEDDTRLF----------VYAALENYMDQVSGSPGRGRHCLL 148
                  .|.||...... |.||.:|...|..          .|.::.|::.....:   |..|||
  Fly    84 VGGNVTPINARQDGGDF-SQDEDNEVRRRSVGSPPPFRRHDFYRSIINFLTHYGFN---GSACLL 144

  Fly   149 RGICE--NAQVHHHVGIMAELLVVLLTPGKT-------RLDVAYKEALAAGQAGIDCLARYSDCP 204
            |.|||  .:.:....|::..|..:|..|..:       .:|..|| |..||..|..|....:.| 
  Fly   145 RTICEVSESPLDDQNGLLGSLFQILFMPTTSAAEQELQHVDELYK-ASDAGTHGPGCSEYVAHC- 207

  Fly   205 RGESVLDAYAL 215
             |.|.||..::
  Fly   208 -GHSALDLISI 217

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG14829NP_648089.2 DM4_12 117..210 CDD:214785 27/112 (24%)
CG14115NP_648629.1 DM4_12 116..214 CDD:214785 27/104 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C48698
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 P PTHR21398
RoundUp 00.000 Not matched by this tool.
22.030

Return to query results.
Submit another query.