DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG14829 and CG14115

DIOPT Version :10

Sequence 1:NP_648089.2 Gene:CG14829 / 38792 FlyBaseID:FBgn0035751 Length:219 Species:Drosophila melanogaster
Sequence 2:NP_648629.1 Gene:CG14115 / 39487 FlyBaseID:FBgn0036343 Length:219 Species:Drosophila melanogaster


Alignment Length:32 Identity:13/32 - (40%)
Similarity:17/32 - (53%) Gaps:7/32 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly    93 LPLCVLFRRNSQEILRESTSSIHGSTVSSVAY 124
            ||:|.||     .:|....||:|.|  ||.|:
  Fly    40 LPICGLF-----FVLPLFFSSVHFS--SSTAF 64

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG14829NP_648089.2 DM4_12 117..210 CDD:214785 4/8 (50%)
CG14115NP_648629.1 DM4_12 116..214 CDD:214785
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.