DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG14829 and CG7201

Sequence 1:NP_648089.2 Gene:CG14829 FlyBaseID:FBgn0035751 Length:219 Species:Drosophila melanogaster
Sequence 2:NP_001261574.1 Gene:CG7201 FlyBaseID:FBgn0035865 Length:345 Species:Drosophila melanogaster

Alignment Length:185 Identity:40/186 (22%)
Similarity:70/186 (38%) Gaps:49/186 (26%)


  Fly    28 VGQNITEYMHARQKRHQLIYRNGGTIRLVVGPVLSTQLEDPVVWRSLVYYYVLHFGAFTLPSAPL 92
            ||:.:..|:|.::::..|..:.            |...||        :.:.:|      ...|.
  Fly   151 VGEYVARYLHVQRRKRDLSEQR------------SRSNED--------HPFRIH------EEGPK 189

  Fly    93 YPWDKWETIYARSLQEKIRSLDETHEDDTRLFVYAALENYMDQVSGSPGRGRHCLLRGICE-NAQ 156
            ||             |....|........|:.:|..:|:::......   |:.||||.||| :::
  Fly   190 YP-------------ELPAGLQHIFHGGERVLLYGVVEDFLSTFGMD---GKACLLRTICEMHSR 238

  Fly   157 VHHHVGIMAELLVVLLTPGKTRL-DVA--YKEALAAG---QAGIDCLARYSDCPR 205
            .....|:..|:..:.||..|:.. |:.  |.:|...|   ||..:|...:.|||:
  Fly   239 SLEKFGVFGEMTKLFLTVTKSPFSDLVPDYVQAQEVGEGKQAPGECFPYFKDCPK 293

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG14829NP_648089.2 DM4_12 117..210 CDD:214785 26/97 (27%)
CG7201NP_001261574.1 DM4_12 201..298 CDD:214785 26/97 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 P PTHR21398
RoundUp 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.