DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG14829 and CG33262

Sequence 1:NP_648089.2 Gene:CG14829 FlyBaseID:FBgn0035751 Length:219 Species:Drosophila melanogaster
Sequence 2:NP_996071.2 Gene:CG33262 FlyBaseID:FBgn0053262 Length:208 Species:Drosophila melanogaster

Alignment Length:207 Identity:56/208 (27%)
Similarity:87/208 (42%) Gaps:38/208 (18%)


  Fly    18 RSAYMLVAAP-----VGQNITEYMHARQKRHQLIYRNGGT-IRLVVGPVLSTQLEDPVVWRSLVY 76
            ||.::.|.|.     :.:..::.:|:|.||..:..|...| .:.:.|..:...||    :.||..
  Fly     3 RSMWLSVCATLCLIFLQEVASQDVHSRSKRFLIFPRQAPTRHQFIAGIGIPADLE----YESLTV 63

  Fly    77 YYVLH------FGAFTLPSAPLYPWDKWETIYARSLQEKIRSLDETHEDDTRLFVYAALENYMDQ 135
            .|||.      :.|......||:|..|..||.|:. |.|: .:..|   |.|..:|..:|:   .
  Fly    64 GYVLKAEYYLPYNATVYRQNPLFPEYKPNTIDAQD-QRKL-FMKPT---DLRWQLYQFIEH---M 120

  Fly   136 VSGSPGRGRHCLLRGICE--NAQVHHHVGIMAELLVVLLTPGKT-------RLDVAYKEALAAGQ 191
            ::|....|..|||..|||  |.:.........|:|.:||:|..|       .||....|...:.:
  Fly   121 LNGYGLNGHACLLEAICEANNIKFAKDFSTAGEMLHLLLSPSSTLNSESNRALDFILAEKDGSRR 185

  Fly   192 AGIDCLARYSDC 203
               || ::| ||
  Fly   186 ---DC-SKY-DC 192

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG14829NP_648089.2 DM4_12 117..210 CDD:214785 27/97 (28%)
CG33262NP_996071.2 DM4_12 110..192 CDD:285126 25/90 (28%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 P PTHR21398
RoundUp 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.