DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG14829 and CG33342

Sequence 1:NP_648089.2 Gene:CG14829 FlyBaseID:FBgn0035751 Length:219 Species:Drosophila melanogaster
Sequence 2:NP_001097904.1 Gene:CG33342 FlyBaseID:FBgn0086610 Length:219 Species:Drosophila melanogaster

Alignment Length:197 Identity:57/198 (29%)
Similarity:94/198 (47%) Gaps:22/198 (11%)


  Fly    21 YMLVAAPVG----QNITEYMHARQKRHQLIYRNGGTIRLVVGPVLSTQLEDPV--VWRSLVYYYV 79
            ::|.|:..|    :|.:..:...:.:...|:...||.::|.|.....:..|.|  ||.      .
  Fly    19 FVLAASAAGDGNDRNASPGLSLSRTKRLAIFNGQGTNKIVAGLAFPIKQADTVQSVWG------F 77

  Fly    80 LHFGAFTLPS-APLYPWDKWET----IYARSLQEKIRSLDETHEDDTRLFVYAALENYMDQVSGS 139
            :::.|..:|| .|:|.|..|.|    ..||..::.|||  ...:|:||:::|..:|..:::: |.
  Fly    78 VNYQAQYVPSPVPIYWWSFWNTSTFLSTAREWRKGIRS--RVFQDETRVWLYDVVETGLERL-GD 139

  Fly   140 PGRGRHCLLRGICENAQ-VHHHVGIMAELLVVLLTPGKTRLDVAYKEALAAGQAGIDCLARYSDC 203
            ...|. |||:.|||.:| ...|..|..|:|..:|.|....:...|..|..||:||.:|...||||
  Fly   140 RNAGA-CLLKCICEISQRPFMHNSIFGEILNAVLVPSLDNVPEKYLHARNAGKAGANCRKTYSDC 203

  Fly   204 PR 205
            .:
  Fly   204 SK 205

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG14829NP_648089.2 DM4_12 117..210 CDD:214785 31/91 (34%)
CG33342NP_001097904.1 DM4_12 123..203 CDD:285126 28/82 (34%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C130746498
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 P PTHR21398
RoundUp 00.000 Not matched by this tool.
22.030

Return to query results.
Submit another query.