DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG14826 and CG34184

DIOPT Version :9

Sequence 1:NP_001097528.2 Gene:CG14826 / 38791 FlyBaseID:FBgn0035750 Length:219 Species:Drosophila melanogaster
Sequence 2:NP_001097310.1 Gene:CG34184 / 5740423 FlyBaseID:FBgn0085213 Length:224 Species:Drosophila melanogaster


Alignment Length:203 Identity:48/203 - (23%)
Similarity:74/203 - (36%) Gaps:49/203 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly    38 LIYQNSGSLKFSIGPSMPIPLGDKVTFRSCVLSYTLQGGSYS----LPTSPIWPWDKWEGTFARS 98
            |:||.:......:..|:|:.|.::..|    |||..:...|.    ....||...|.||.::.  
  Fly    21 LLYQTNSEFGIFMAISVPLTLKNRNVF----LSYNYEFNYYQPEHVYKYPPILMGDNWEDSYL-- 79

  Fly    99 LMQMRRNIERHVANGG--------VRYADD------------ARLLVYTALEEYMGRRNNDRSMG 143
                     .:...||        .|..||            :|...|..|::.:.|....   .
  Fly    80 ---------TYNTTGGDDSSSSRSFRSVDDNSSTQKRTLPIMSRTNFYIMLKDKLERSGYP---A 132

  Fly   144 RQCLLRSICE--NAQIHHHIGVFSEIMDIVLSPGKA---DLDNDYHDAYAAGRAGANCLGLYSAC 203
            ..||||.|||  ::.:....|:...|:.|:.:|..:   :||.||:.|...|....:|....|.|
  Fly   133 ESCLLRLICETNSSTLGEVNGLLGSIVHILFTPSSSNDENLDKDYYQAEWDGLRHGDCSFYASQC 197

  Fly   204 PRGHNFLD 211
            .  .|.||
  Fly   198 E--ENVLD 203

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG14826NP_001097528.2 DM4_12 117..210 CDD:214785 27/109 (25%)
CG34184NP_001097310.1 DM4_12 114..197 CDD:285126 23/85 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45452573
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR21398
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.940

Return to query results.
Submit another query.