DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG14826 and CG13616

Sequence 1:NP_001097528.2 Gene:CG14826 FlyBaseID:FBgn0035750 Length:219 Species:Drosophila melanogaster
Sequence 2:NP_651262.1 Gene:CG13616 FlyBaseID:FBgn0039200 Length:231 Species:Drosophila melanogaster

Alignment Length:225 Identity:43/226 (19%)
Similarity:85/226 (38%) Gaps:59/226 (26%)


  Fly     8 LLAVAML---------SLPSRGDSSRNLTEFMGHRQKRWLIYQNSGSLKFSIGPSMPIPLGDKVT 63
            |||:.:|         |:.|..:.:..:|:.: .|.||:|.:....|:..::..::.:.....|.
  Fly    11 LLALCLLLHEVQSQVMSMSSAANRTGEVTKVL-RRHKRYLAFPEGSSVSGAVCMTIGMIGNPDVD 74

  Fly    64 FRSCVLSYTLQGGSYSLPTSPIWPWDKW--------EGTFARSLMQMRRNIERHVANGGVRYADD 120
            :.|..:::   |.:|.||.      .:|        ..|.|:..::.|                 
  Fly    75 YLSWAVNW---GVAYDLPN------HQWVIQHAHGLNATLAKDTIKRR----------------- 113

  Fly   121 ARLLVYTALEEYMGRRNNDRSMGRQCLLRSICENAQIH----HHIGVFSEIMDIVLS--PG---- 175
            :|...|   :|.....:|....||.|:.|::||:|:..    ....:..|::..|.|  |.    
  Fly   114 SRRAFY---DEVQSLFDNMGFNGRSCVARALCESAKFMLPSVERGNMLQELVRTVFSLPPSPVAA 175

  Fly   176 -KADLDNDYHDAY-AAGRAGANCLGLYSAC 203
             :....:.|...| .:.|:..:|..:|..|
  Fly   176 HEPQAHHQYDRIYRRSKRSSRDCHEIYPGC 205

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG14826NP_001097528.2 DM4_12 117..210 CDD:214785 21/100 (21%)
CG13616NP_651262.1 DM4_12 110..212 CDD:214785 22/117 (19%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C49145
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 P PTHR21398
RoundUp 00.000 Not matched by this tool.
22.030

Return to query results.
Submit another query.