DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG14826 and CG5768

Sequence 1:NP_001097528.2 Gene:CG14826 FlyBaseID:FBgn0035750 Length:219 Species:Drosophila melanogaster
Sequence 2:NP_651260.3 Gene:CG5768 FlyBaseID:FBgn0039198 Length:262 Species:Drosophila melanogaster

Alignment Length:215 Identity:46/216 (21%)
Similarity:81/216 (38%) Gaps:59/216 (27%)


  Fly    22 SSRNLTEFMGHRQKRWLIYQNSGSLKFSIGPSMPIPLGDKVTFRSCVLSYTLQGGSYSLPTSPIW 86
            |.|.|:     |.||::.:....|...::..:..:.....:.:.|..:::   |.:|.|| :..|
  Fly    76 SQRKLS-----RGKRFVAFPQGSSASGAVCLTTGVIGNPNLLYLSLGINW---GVAYDLP-NVTW 131

  Fly    87 PWDKWEG--TFARSLMQMRRNIERHVANGGVRYADDARLLVYTALE---EYMGRRNNDRSMGRQC 146
            ......|  |...:..|::|   ||            |..:|..||   :.||..      ||.|
  Fly   132 VLQNAHGWTTKKSAQAQIKR---RH------------RRELYGRLETMIDSMGYN------GRDC 175

  Fly   147 LLRSICENAQIHHH--IGVFSEIMDIVLSPGK-----------ADL---DNDYHDAYAAGRAGAN 195
            :||::||:.|....  :.:..|::..:.|..|           ||:   |..|.:|:.......|
  Fly   176 ILRTLCESRQYFQRTKMSMVGEMLRTIFSLPKQRIFTRELHENADIVHYDQAYRNAHTDDCTQYN 240

  Fly   196 C--------LGLYSACPRGH 207
            |        .|.|:..|:.:
  Fly   241 CHFSLLELAFGKYTTPPKNY 260

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG14826NP_001097528.2 DM4_12 117..210 CDD:214785 27/119 (23%)
CG5768NP_651260.3 DM4_12 149..248 CDD:214785 27/120 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C49149
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 P PTHR21398
RoundUp 00.000 Not matched by this tool.
22.030

Return to query results.
Submit another query.