DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG14826 and CG13613

Sequence 1:NP_001097528.2 Gene:CG14826 FlyBaseID:FBgn0035750 Length:219 Species:Drosophila melanogaster
Sequence 2:NP_001097900.2 Gene:CG13613 FlyBaseID:FBgn0039193 Length:219 Species:Drosophila melanogaster

Alignment Length:190 Identity:51/191 (27%)
Similarity:84/191 (44%) Gaps:37/191 (19%)


  Fly    38 LIYQNSGSLKFSIGPSMPIPLGDKV-TFRSCVLSYTLQGGSYSLP-------TSPIWPWDKWEGT 94
            |::..|..|:.:...|:|..|..:. .|..  :.:.:   :|:||       .:.||. |:....
  Fly    30 LLFPTSTVLQLTSSISIPADLNTRTKVFMD--MGFQM---NYNLPPTVSAFYNATIWA-DELSRR 88

  Fly    95 FARSL-MQMRRNIERHVANGGVRYADDARLLVYTALEEYMGRRNNDRSMG--RQCLLRSICENAQ 156
            ..|.| ..:..|::::...||:..||      :||.:.|.|..|...:.|  |.|||||:||.| 
  Fly    89 QKRQLDHSLDANLQQYDLEGGMHPAD------FTAGQLYKGIENMLETYGFHRSCLLRSVCELA- 146

  Fly   157 IH-----HHIGVFSEIMDIVLSP----GKADLDNDYHDAY----AAGRAGANCLGLYSAC 203
            :|     |..|:.::::..:|:|    |.||.:..|.|.|    ..|..|..|...|.:|
  Fly   147 LHPFAEDHFYGMVTQVITFLLTPSQHEGFADDEQHYRDKYEKAEQIGFLGGQCHLSYPSC 206

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG14826NP_001097528.2 DM4_12 117..210 CDD:214785 33/103 (32%)
CG13613NP_001097900.2 DM4_12 119..206 CDD:285126 28/88 (32%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C48997
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 P PTHR21398
RoundUp 00.000 Not matched by this tool.
22.030

Return to query results.
Submit another query.