DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG14826 and CG17784

Sequence 1:NP_001097528.2 Gene:CG14826 FlyBaseID:FBgn0035750 Length:219 Species:Drosophila melanogaster
Sequence 2:NP_651254.1 Gene:CG17784 FlyBaseID:FBgn0039192 Length:237 Species:Drosophila melanogaster

Alignment Length:190 Identity:65/191 (34%)
Similarity:97/191 (51%) Gaps:18/191 (9%)


  Fly    17 PSRGDSSRNLTEFMGHRQKRWLIYQNSGSLKFSIGPSMPIPLGDKVTFRSCVLSYTLQGGSYSLP 81
            |...|:| :||..  .|.||..||...|.:|  :.||:..|:......:|....:.|||  ..:|
  Fly    46 PDESDNS-SLTSL--SRSKRVAIYNGQGVVK--LVPSLAYPVKQTDKEQSFWWFFNLQG--QWIP 103

  Fly    82 TS-PIWPWDKWEGT-FARSLMQMRRNIERHVANGGVRYADDARLLVYTALEEYMGRRNNDRSMGR 144
            |: |::.|..|..| |..:..:.|::::..|.:      |:||..||.|:|  :|....|.:.|.
  Fly   104 TTIPLYWWSFWNTTAFVSTAREWRKDMQAKVLH------DEARTWVYNAIE--VGMEQLDGAYGG 160

  Fly   145 QCLLRSICENAQ-IHHHIGVFSEIMDIVLSPGKADLDNDYHDAYAAGRAGANCLGLYSAC 203
            .||||||||.:| ...:..:||||::.||.|...::.:.|..|..|||.||:|...||.|
  Fly   161 VCLLRSICEISQKPFQNSNIFSEIVNAVLVPTLDNVASKYLHARDAGRGGADCERTYSDC 220

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG14826NP_001097528.2 DM4_12 117..210 CDD:214785 37/89 (42%)
CG17784NP_651254.1 DM4_12 135..227 CDD:214785 37/95 (39%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C130746615
eggNOG 1 0.900 E1_2E2BX
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 P PTHR21398
RoundUp 00.000 Not matched by this tool.
32.930

Return to query results.
Submit another query.