DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG14826 and CG13869

Sequence 1:NP_001097528.2 Gene:CG14826 FlyBaseID:FBgn0035750 Length:219 Species:Drosophila melanogaster
Sequence 2:NP_611458.2 Gene:CG13869 FlyBaseID:FBgn0034486 Length:215 Species:Drosophila melanogaster

Alignment Length:200 Identity:66/200 (33%)
Similarity:102/200 (51%) Gaps:29/200 (15%)


  Fly    25 NLTEFMGH-RQKRWLIYQNSGSLKFSIGPSMPIPLGDKVTFRSCV--LSYTLQGGSYSLPTSPIW 86
            |||.:..| ||||:|||||.|.:||..|.:.|.|..:|..:|..|  :::..|   ::.|.:||:
  Fly    23 NLTSWRHHRRQKRFLIYQNGGVIKFVSGCAFPAPFMEKKAWRQLVWLMNFHYQ---FNEPQTPIY 84

  Fly    87 PWDKWEGTFARSLMQMRRNIERHVANGGV------RYADDARLLVYTALEEYMGRRNNDRSMGRQ 145
            .|..|:|:         ||::..:.....      ...|:.:||::...|.||.:...:   |..
  Fly    85 WWKLWDGS---------RNLKGPLTQPAPPSVPARLLVDEPQLLLFKFAEAYMNQLGQN---GSA 137

  Fly   146 CLLRSICENAQIHHHIGVFSEIMDIVLSPGKADLDNDYHDAYAAGRAGANCLGLYSACPRGHN-F 209
            ||.|.||||.|:..|.|::::::..:|.|.:. ||..|.|||..||.|.:|   .:|.|..|: .
  Fly   138 CLDRLICENGQVDEHSGLYAQLLHRLLRPHQT-LDVRYLDAYRMGRHGVDC---RNAFPEAHHCI 198

  Fly   210 LDGLL 214
            ||..|
  Fly   199 LDDYL 203

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG14826NP_001097528.2 DM4_12 117..210 CDD:214785 32/94 (34%)
CG13869NP_611458.2 DM4_12 114..204 CDD:214785 35/97 (36%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C130746454
eggNOG 1 0.900 E1_2E2BX
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 P PTHR21398
RoundUp 00.000 Not matched by this tool.
32.930

Return to query results.
Submit another query.