DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG14826 and CG33262

DIOPT Version :9

Sequence 1:NP_001097528.2 Gene:CG14826 / 38791 FlyBaseID:FBgn0035750 Length:219 Species:Drosophila melanogaster
Sequence 2:NP_996071.2 Gene:CG33262 / 2768975 FlyBaseID:FBgn0053262 Length:208 Species:Drosophila melanogaster


Alignment Length:153 Identity:36/153 - (23%)
Similarity:58/153 - (37%) Gaps:31/153 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly    33 RQKRWLIYQNSGSLK--FSIGPSMPIPLGDKVTFRSCVLSYTLQGGSYSLP-------TSPIWPW 88
            |.||:||:......:  |..|..:|..|    .:.|..:.|.|: ..|.||       .:|::|.
  Fly    29 RSKRFLIFPRQAPTRHQFIAGIGIPADL----EYESLTVGYVLK-AEYYLPYNATVYRQNPLFPE 88

  Fly    89 DKWEGTFARSLMQMRRNIERHVANGGVRYADDARLLVYTALEEYMGRRNNDRSMGRQCLLRSICE 153
            .|.....|:...::            .....|.|..:|..:|..:   |.....|..|||.:|||
  Fly    89 YKPNTIDAQDQRKL------------FMKPTDLRWQLYQFIEHML---NGYGLNGHACLLEAICE 138

  Fly   154 --NAQIHHHIGVFSEIMDIVLSP 174
              |.:.........|::.::|||
  Fly   139 ANNIKFAKDFSTAGEMLHLLLSP 161

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG14826NP_001097528.2 DM4_12 117..210 CDD:214785 17/60 (28%)
CG33262NP_996071.2 DM4_12 110..192 CDD:285126 16/55 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR21398
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.